Dbfetch

Dbfetch

LOCUS       XM_024685844            1062 bp    mRNA    linear   PLN 12-APR-2018
DEFINITION  PREDICTED: Selaginella moellendorffii SUMO-activating enzyme
            subunit 1B-1 (LOC9657292), mRNA.
ACCESSION   XM_024685844
VERSION     XM_024685844.1
DBLINK      BioProject: PRJNA50439
KEYWORDS    RefSeq.
SOURCE      Selaginella moellendorffii
  ORGANISM  Selaginella moellendorffii
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_003314307.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Selaginella moellendorffii
                                           Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1062
                     /organism="Selaginella moellendorffii"
                     /mol_type="mRNA"
                     /db_xref="taxon:88036"
                     /chromosome="Unknown"
     gene            1..1062
                     /gene="LOC9657292"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 14 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 9 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:9657292"
     CDS             30..986
                     /gene="LOC9657292"
                     /codon_start=1
                     /product="SUMO-activating enzyme subunit 1B-1"
                     /protein_id="XP_024541612.1"
                     /db_xref="GeneID:9657292"
                     /translation="MEEEAALTEQETAVYDRQIRVWGVQAQRRLSKSRVLVAGLTGVT
                     AEACKNLVLAGIGSLVVLDDRPAVFDPCSSTFLVCHDHNASTDENKSVAEVCAAALRD
                     FNPMVDVTSAQGTSVMDVDNYDVVILNRAAIKDKRRINELCRRSAHKVSFYTVDCIGS
                     RGEIFVDLQTHTYTSKAAADAAESCELTKKFPSFEDVSSVPWNCLPKRISKLFFAMRV
                     LEEFVQATGRQAGPENLPELLALRTQMCSKQGVADSLIPESLLAGLAGADGTEFPPVS
                     AILGGILGQEVVKALSGKGDPLRSFFYFDTDDGKGIIEEIIS"
ORIGIN      
        1 tagggctttt ctagggttct tgaaaagcta tggaggagga ggctgcattg acggagcagg
       61 agacggccgt gtacgatcgc cagattcgtg tgtggggcgt ccaggcgcag agaaggctga
      121 gcaaatctcg agtgcttgtg gctggattga ctggtgtcac agcggaggca tgcaagaatc
      181 tggtcctagc gggaattgga agcctcgttg tgctggacga caggccggcc gtgtttgatc
      241 cttgttcttc cacatttctg gtgtgccatg accacaacgc ttccactgac gagaacaagt
      301 ccgttgccga ggtctgtgct gccgctcttc gagatttcaa cccaatggtc gacgtcacga
      361 gtgctcaagg cacttcagtg atggatgtgg ataactacga cgttgtcatc ctcaaccgtg
      421 ccgctatcaa agacaagagg agaattaatg agctgtgtcg cagatcggct cacaaagttt
      481 ccttctacac tgtcgactgc attggttcgc ggggggaaat ctttgtcgat ttgcagaccc
      541 atacttacac ttccaaggct gcggcggatg ctgccgagag ttgcgagctt acaaagaagt
      601 tcccaagctt tgaggacgta tcaagcgttc cgtggaactg ccttccaaag aggataagta
      661 agctcttctt tgcaatgcga gtcctcgaag aatttgttca ggcgacggga cggcaagccg
      721 gccccgaaaa tcttccggag ctgctcgcgt tgcgaacgca aatgtgcagc aaacagggcg
      781 tggccgactc gttgatcccg gaaagccttc tcgcggggct ggctggcgcg gacggcacgg
      841 agtttccacc ggtgtctgcg attctgggag gcatcctcgg ccaggaagtg gtcaaggctc
      901 tgtctggcaa aggagatcct ttgcgaagct tcttctactt cgacactgac gacggcaaag
      961 gaatcatcga ggagataatc agttagatcg attacacgca cacccatttg tttagggttg
     1021 gggtacctct ttggatcctg gcaaggcatg tagtcacgat tc
//