Dbfetch

Dbfetch

LOCUS       XM_012208538             786 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes post-GPI attachment to proteins factor
            2-like (LOC105627249), mRNA.
ACCESSION   XM_012208538
VERSION     XM_012208538.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130072.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..786
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..786
                     /gene="LOC105627249"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 10 Proteins"
                     /db_xref="GeneID:105627249"
     CDS             1..786
                     /gene="LOC105627249"
                     /codon_start=1
                     /product="post-GPI attachment to proteins factor 2-like"
                     /protein_id="XP_012063928.1"
                     /db_xref="GeneID:105627249"
                     /translation="MLSGAVNMELNNVVSNKSSVYLALSFRRLCLATVGLPLVSLLFC
                     FITAYIFQQDDIHETHCRVYNILPSISAITGVSPQRYLWRISIALHIGPRLVIASVYH
                     SYYYKILKNIEDVPLQITGSRLLNLCYWLNIAEIAALSGVTYISNRENYSVHEKIFIV
                     FMISSLTYMLTAVRLGRLITPNAQSLQYKQVLFMTSLVSTIFLIIFFLKHRLLCHDLA
                     FSWFSLCEYVIAFANMGFHITVVSDFPEEQLIVGHGLPAVKID"
ORIGIN      
        1 atgttaagcg gtgctgtcaa tatggaactg aataatgttg tgagcaacaa aagttccgta
       61 tatcttgcac tgtcgtttcg taggctgtgc ctggcgacag ttggcttacc acttgtgtcg
      121 ctattattct gcttcatcac agcatatata tttcaacagg acgatattca cgaaactcat
      181 tgtagggtct ataatattct tccatcgatc tcagccatta ctggagtatc tccacagaga
      241 tatttatggc gtatcagtat agcattacat attggtccta gactggttat cgccagtgtt
      301 tatcattcat attattacaa gatacttaag aacattgaag atgtgcctct acaaattaca
      361 gggagcaggc tcctaaacct atgctattgg ctaaacattg ccgagatagc agctttgtct
      421 ggtgtaacat atatttctaa cagagaaaat tattcggtgc acgaaaaaat tttcatagtg
      481 ttcatgatta gctcgctcac atatatgttg actgctgtga gattgggtcg tttaataact
      541 ccaaatgcac aaagtcttca gtacaaacaa gtgcttttta tgacaagtct cgtcagtaca
      601 atctttctta ttattttctt cttaaaacat cgactgctgt gtcacgattt ggcatttagt
      661 tggttttcac tatgtgagta cgtgatagct tttgcaaata tgggctttca catcactgtg
      721 gtttcggact ttccagaaga acaactgatc gtaggtcacg gtttacctgc cgtaaaaata
      781 gattaa
//