Dbfetch

Dbfetch

LOCUS       XM_012207446             657 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes transient-receptor-potential-like
            protein (LOC105626134), mRNA.
ACCESSION   XM_012207446
VERSION     XM_012207446.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130068.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 29% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..657
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..657
                     /gene="LOC105626134"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:105626134"
     CDS             1..657
                     /gene="LOC105626134"
                     /codon_start=1
                     /product="transient-receptor-potential-like protein"
                     /protein_id="XP_012062836.1"
                     /db_xref="GeneID:105626134"
                     /translation="MGNTLSVNAIEITENLFFAIFGQKGTENFSLNINQQPKWTVYFF
                     KVSFSLYMLVSVIVLINLLIAMMTDTYHNIQSQSDIEWKYGLSKLVRKMQKTRTAPFP
                     LNLVTTWAEYIKNACVKERIARQKIRSRGYMEPDAQRIFPKFSTNSRMLPLPRAAKER
                     INFSLLQSNSTTSQTSLNNIPKIQNIVDWDIVRRKYRMRFGDEIEKPSSGEVTLAKMA
                     "
ORIGIN      
        1 atggggaata ccctgtcagt taatgcgatc gaaatcacgg agaatctttt cttcgccatt
       61 ttcggccaaa aaggtaccga aaacttttca ttaaacataa accagcagcc aaagtggacg
      121 gtttattttt tcaaggtatc attctcatta tacatgctcg tcagtgtcat agtattgatt
      181 aatctattaa ttgctatgat gactgacaca tatcacaaca ttcaatcaca gagtgatatc
      241 gaatggaaat acggtctcag caaactagtt cgtaagatgc aaaaaacaag aacagcccca
      301 ttcccgttaa atctcgttac tacatgggca gaatatatta agaacgcttg tgtgaaagaa
      361 cgtattgcaa ggcagaaaat cagatcgcgt gggtacatgg aacccgatgc gcaaaggatt
      421 tttccaaaat tttctactaa tagtagaatg cttccactac cgcgagcagc aaaggaacga
      481 attaatttct ccttacttca atcaaactcg actaccagtc aaacttcttt aaataatatt
      541 ccgaagatac aaaatatcgt tgattgggat atagttcgtc gaaaatatcg tatgcgattc
      601 ggagacgaaa tcgagaaacc gtccagtggg gaggtgacgc ttgctaaaat ggcttga
//