Dbfetch

Dbfetch

LOCUS       XM_012205786             636 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes uncharacterized LOC105624420
            (LOC105624420), mRNA.
ACCESSION   XM_012205786
VERSION     XM_012205786.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130141.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..636
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..636
                     /gene="LOC105624420"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:105624420"
     CDS             1..636
                     /gene="LOC105624420"
                     /codon_start=1
                     /product="uncharacterized protein LOC105624420"
                     /protein_id="XP_012061176.1"
                     /db_xref="GeneID:105624420"
                     /translation="MKKDRISKKQNISSIEEIPKLVNFRKLRQANVILHGKSAGFPTQ
                     KFQRELQDLFAENTALLRCNEGTFRVRKIYGDGNCMFRAISYILWRNEEEHQSLRAMV
                     VQHIKDNWREYGPFVIAEWNISDCQEYYDYMSLIGTFASELECTVATKLHRMNLSIYR
                     ELPGRYELKLVFHNRVNINYETARLLFTGCSESGHYDVLLPNSMSSFFMGQ"
ORIGIN      
        1 atgaaaaagg acagaatctc gaagaaacaa aatatttctt cgatcgagga gattccaaaa
       61 ttagtaaatt ttcgaaaact cagacaagca aacgtgattc tgcatggcaa atctgctggg
      121 tttccaacac aaaaatttca acgcgaacta caagatctat ttgcagaaaa tacggctcta
      181 ttaaggtgta acgagggcac gtttcgcgtg cggaaaatat atggagatgg gaattgcatg
      241 tttagagcga tcagctatat tttgtggcga aacgaggaag agcatcaatc gctccgagct
      301 atggttgtgc agcatattaa ggacaattgg cgcgagtacg gtccattcgt gatagctgaa
      361 tggaacattt cggattgcca agagtactac gattacatga gtctaatagg cacatttgcc
      421 agcgagctgg aatgcacggt agccacaaaa cttcatcgca tgaatctttc gatttatcgt
      481 gaacttcctg gcagatatga gcttaagttg gtcttccata accgcgtgaa catcaactat
      541 gaaaccgcga gactcctatt caccggatgt tctgaaagcg gtcattatga tgttttgtta
      601 cccaattcaa tgtcaagctt ttttatgggc caataa
//