Dbfetch
LOCUS XM_012204923 258 bp mRNA linear INV 02-APR-2015
DEFINITION PREDICTED: Atta cephalotes odorant receptor 43a-like
(LOC105623531), mRNA.
ACCESSION XM_012204923
VERSION XM_012204923.1
DBLINK BioProject: PRJNA279976
KEYWORDS RefSeq; includes ab initio.
SOURCE Atta cephalotes
ORGANISM Atta cephalotes
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_012130122.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Atta cephalotes Annotation Release
100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 6.2
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 2% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..258
/organism="Atta cephalotes"
/mol_type="mRNA"
/db_xref="taxon:12957"
/chromosome="Unknown"
/sex="male"
gene 1..258
/gene="LOC105623531"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 1 Protein"
/db_xref="GeneID:105623531"
CDS 1..258
/gene="LOC105623531"
/codon_start=1
/product="odorant receptor 43a-like"
/protein_id="XP_012060313.1"
/db_xref="GeneID:105623531"
/translation="MNTFLYCGAGEIITEQSNAVYRAVCDLEWYKLKSSKARNLIMLM
IRAKYPFYITAGKIFPLTMATFCNILKSSIGYISFLLTKHG"
ORIGIN
1 atgaatactt ttctctattg tggagcagga gaaattataa cagaacaaag caatgctgta
61 tatcgtgcag tgtgcgatct tgaatggtac aagttgaaat caagtaaggc aagaaatctt
121 attatgttaa tgatacgagc taaatatcct ttttatatca ctgcaggaaa gatttttcca
181 ctaacaatgg ctactttttg caatatatta aaatcatcga ttggctacat atcattccta
241 ttgacaaaac atggctga
//