Dbfetch
LOCUS XM_012204800 900 bp mRNA linear INV 02-APR-2015 DEFINITION PREDICTED: Atta cephalotes transmembrane protein 164 (LOC105623407), mRNA. ACCESSION XM_012204800 VERSION XM_012204800.1 DBLINK BioProject: PRJNA279976 KEYWORDS RefSeq; corrected model. SOURCE Atta cephalotes ORGANISM Atta cephalotes Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_012130121.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Atta cephalotes Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-318 ADTU01024193.1 3737-4054 c 319-435 ADTU01024193.1 3494-3610 c 436-514 ADTU01024193.1 3348-3426 c 515-615 ADTU01024193.1 3149-3249 c 616-819 ADTU01024193.1 2868-3071 c 820-820 "N" 1-1 821-900 ADTU01024193.1 2788-2867 c FEATURES Location/Qualifiers source 1..900 /organism="Atta cephalotes" /mol_type="mRNA" /db_xref="taxon:12957" /chromosome="Unknown" /sex="male" gene 1..900 /gene="LOC105623407" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:105623407" CDS 1..900 /gene="LOC105623407" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: transmembrane protein 164" /protein_id="XP_012060190.1" /db_xref="GeneID:105623407" /translation="MFQWAYGGVNGSIPRNVGPECASYLTLKRRIIETLFISVFIISC IIWGLKRITLPKKLAYVGQDRVGRRVLLIMMSLVLGMEIGFKFTSRTVIYLLNPCHIT TALQLYLLAADPSPMVTTIFRIHLNLLNGPVLAYLFPETESRIIFADKALYYIQHGLM LIIPYYLLRIGGVYNIEPLSDMSWSILSYGLNVGYHFWIVQSVALPVQVNLSHMLCAA VLDPFEGQNYRLWAVTHQLILCPTLCKLFCYISNFLLTKFPLTRVKPSLECIIPKXNY TYEQNEKLCEESNTSGNGHTHFD" ORIGIN 1 atgttccagt gggcatatgg tggtgtgaat ggctctatac cacgcaatgt cggtccggaa 61 tgcgcgagtt acttaacact gaaacgacgg ataatagaaa ctttgtttat atctgtattt 121 attatatcct gtattatatg gggtctcaaa cgaataactt tgccaaagaa actagcttac 181 gttggccagg accgtgtagg caggcgagtc ttgttgatta tgatgtcatt ggtcctgggg 241 atggaaatcg gttttaaatt caccagcaga actgtcatat atctattaaa tccttgtcat 301 attacaacag cattacagtt atatttgctg gctgcggatc ctagcccaat ggtcactact 361 atctttagga tacatttgaa tctgttgaat ggaccggtat tagcatatct atttccagaa 421 acagagtctc gcattatatt tgcagacaaa gcattgtact atattcagca tggtttgatg 481 cttataatac catattattt attgaggatt ggaggtgtat ataatattga gcccttatct 541 gatatgagct ggtcaatcct cagttatggc cttaatgtag gatatcactt ttggattgtt 601 caaagtgttg ccttgcctgt acaggtgaat cttagtcata tgttatgtgc agctgttttg 661 gatccatttg aaggtcaaaa ttatcgatta tgggcagtaa ctcatcaatt aatattatgt 721 cccactttgt gcaagctgtt ttgttatata tctaattttt tattgactaa gtttccatta 781 actagagtta agccatcgct ggaatgcatt attccaaaan aaaattatac atatgaacag 841 aatgaaaaat tatgtgaaga atctaacacc tcaggaaatg gccatacaca ttttgattaa //