Dbfetch

LOCUS       XM_012204800             900 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes transmembrane protein 164
            (LOC105623407), mRNA.
ACCESSION   XM_012204800
VERSION     XM_012204800.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq; corrected model.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130121.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-318               ADTU01024193.1     3737-4054           c
            319-435             ADTU01024193.1     3494-3610           c
            436-514             ADTU01024193.1     3348-3426           c
            515-615             ADTU01024193.1     3149-3249           c
            616-819             ADTU01024193.1     2868-3071           c
            820-820             "N"                1-1
            821-900             ADTU01024193.1     2788-2867           c
FEATURES             Location/Qualifiers
     source          1..900
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..900
                     /gene="LOC105623407"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 1 base in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 4 Proteins"
                     /db_xref="GeneID:105623407"
     CDS             1..900
                     /gene="LOC105623407"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: transmembrane protein 164"
                     /protein_id="XP_012060190.1"
                     /db_xref="GeneID:105623407"
                     /translation="MFQWAYGGVNGSIPRNVGPECASYLTLKRRIIETLFISVFIISC
                     IIWGLKRITLPKKLAYVGQDRVGRRVLLIMMSLVLGMEIGFKFTSRTVIYLLNPCHIT
                     TALQLYLLAADPSPMVTTIFRIHLNLLNGPVLAYLFPETESRIIFADKALYYIQHGLM
                     LIIPYYLLRIGGVYNIEPLSDMSWSILSYGLNVGYHFWIVQSVALPVQVNLSHMLCAA
                     VLDPFEGQNYRLWAVTHQLILCPTLCKLFCYISNFLLTKFPLTRVKPSLECIIPKXNY
                     TYEQNEKLCEESNTSGNGHTHFD"
ORIGIN      
        1 atgttccagt gggcatatgg tggtgtgaat ggctctatac cacgcaatgt cggtccggaa
       61 tgcgcgagtt acttaacact gaaacgacgg ataatagaaa ctttgtttat atctgtattt
      121 attatatcct gtattatatg gggtctcaaa cgaataactt tgccaaagaa actagcttac
      181 gttggccagg accgtgtagg caggcgagtc ttgttgatta tgatgtcatt ggtcctgggg
      241 atggaaatcg gttttaaatt caccagcaga actgtcatat atctattaaa tccttgtcat
      301 attacaacag cattacagtt atatttgctg gctgcggatc ctagcccaat ggtcactact
      361 atctttagga tacatttgaa tctgttgaat ggaccggtat tagcatatct atttccagaa
      421 acagagtctc gcattatatt tgcagacaaa gcattgtact atattcagca tggtttgatg
      481 cttataatac catattattt attgaggatt ggaggtgtat ataatattga gcccttatct
      541 gatatgagct ggtcaatcct cagttatggc cttaatgtag gatatcactt ttggattgtt
      601 caaagtgttg ccttgcctgt acaggtgaat cttagtcata tgttatgtgc agctgttttg
      661 gatccatttg aaggtcaaaa ttatcgatta tgggcagtaa ctcatcaatt aatattatgt
      721 cccactttgt gcaagctgtt ttgttatata tctaattttt tattgactaa gtttccatta
      781 actagagtta agccatcgct ggaatgcatt attccaaaan aaaattatac atatgaacag
      841 aatgaaaaat tatgtgaaga atctaacacc tcaggaaatg gccatacaca ttttgattaa
//