Dbfetch

Dbfetch

LOCUS       XM_012204117             426 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes PAXIP1-associated glutamate-rich protein
            1 (LOC105622704), mRNA.
ACCESSION   XM_012204117
VERSION     XM_012204117.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130112.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..426
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..426
                     /gene="LOC105622704"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 6 Proteins"
                     /db_xref="GeneID:105622704"
     CDS             1..426
                     /gene="LOC105622704"
                     /codon_start=1
                     /product="PAXIP1-associated glutamate-rich protein 1"
                     /protein_id="XP_012059507.1"
                     /db_xref="GeneID:105622704"
                     /translation="MERTEEDWFVECSDDEKYEMDEKHKWNIKAEEMLSLIEGLEINN
                     CILELEWKCPGRRGPSPVPSNNLQQELESPEYKTEEKSDFDFMDEMSLPRLPVRRIGE
                     STPKGSAKKKIASFNGVISTMLRHRRLEQQEINSSPKKR"
ORIGIN      
        1 atggaacgca ctgaagaaga ttggtttgta gagtgttcag atgatgagaa atatgaaatg
       61 gatgaaaagc ataaatggaa tataaaggct gaggagatgc tctcattaat tgaaggttta
      121 gaaataaata attgtattct agaacttgaa tggaagtgtc ctggtagacg agggccttct
      181 cctgttcctt caaacaattt acaacaggag cttgaatctc cagaatataa aactgaagaa
      241 aagtctgact ttgattttat ggatgaaatg tcattaccaa gattacctgt tcggaggatt
      301 ggcgaaagta ctccaaaagg tagtgccaag aaaaaaattg ctagctttaa tggagtaata
      361 tctacaatgt taagacatcg tagattggag caacaagaaa taaattcaag tccaaaaaaa
      421 aggtga
//

Unexpected Error when closing connection to refseq from NCBI E-utilities. Non-zero exit status returned (255). STDERR: "http status: 429 Too Many Requests  Too Many Requests at /nfs/public/rw/es/projects/jdbfetch/util/ncbi_refseq_fetch.pl line 124."