Dbfetch

LOCUS       XM_012202946            1695 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes serine/threonine-protein kinase rio1
            (LOC105621479), mRNA.
ACCESSION   XM_012202946
VERSION     XM_012202946.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Holometabola; Hymenoptera; Apocrita; Aculeata;
            Vespoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130098.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1695
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..1695
                     /gene="LOC105621479"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 13 long SRA reads, 7 Proteins"
                     /db_xref="GeneID:105621479"
     CDS             1..1683
                     /gene="LOC105621479"
                     /codon_start=1
                     /product="serine/threonine-protein kinase rio1"
                     /protein_id="XP_012058336.1"
                     /db_xref="GeneID:105621479"
                     /translation="MSEKFEDGQFSDVEEDTLPWAQNKFKGKPLSNGYPKEQLEAEVA
                     NLHITDSKENNGDDIDDDYYCNNDYDLDEKKNTVIKTSSQRSNTQTESTRVINYQPKH
                     KLLSRYANKINLEKYAGPSLPGYVANVLIESDKRVDRDRIRMKDKSDHATIENVLDSR
                     IKNKLHKLFEKGILAEINGCISTGKEANVYYAKSKNKDEIAIKIYRTSILTFRNREKY
                     IRGEYRFDHVHSLSNPRKMVKVWAEKEFSNLKRLEQGGVRAPRPILSGGHLLLMEFLG
                     SDGWAAPKLKDAVLTDSKSRTLYRECIEIMWKMYNKCRLVHADLSEYNMLYHNGSIVV
                     IDVSQAVDRDHCNAMEFLRNDCSNITTFFKKYNVGVMTLQALFDFITDPTINENNMDE
                     YLDIRMQEGNDEKDPQQQEVEEAVFKQAYIPQRLTQVINVERDINLAKSGKDLIYKTL
                     IGLKTDLSKPAEKPEILANKHKADNKSTKEGSDIYTSSEESDDSDSENENETDSEDNK
                     IKFVSSARPRNESPESRKARKKAVKEQQAEKRKVKIKKHVKKRKIKVSRGGK"
ORIGIN      
        1 atgtcggaaa aattcgagga cgggcaattc agcgacgttg aggaggatac actgccttgg
       61 gcgcagaaca aattcaaagg aaaaccttta tctaatggat atcccaagga gcaactcgaa
      121 gcagaagtgg ccaatctgca cattacagac agtaaagaga ataatggaga cgatatcgat
      181 gacgattatt attgtaacaa tgattatgat ttggatgaaa agaagaatac tgtcataaaa
      241 acaagttcgc agagatccaa cactcaaact gaatctacga gggtaataaa ttatcaacct
      301 aaacacaagc tgttatctcg ttatgccaac aaaattaatt tagagaaata tgcgggtccg
      361 tcattaccag gctatgtggc caatgtgctg atcgaaagcg acaaacgggt cgatagagat
      421 cgcataagaa tgaaggacaa aagtgatcat gcgacgattg agaatgtatt ggattcgcgc
      481 attaaaaaca aactacacaa gctgtttgag aaaggaatac tggcagagat aaatggttgt
      541 atctcgactg ggaaagaggc caatgtctat tatgccaagt cgaagaataa agacgagatc
      601 gctatcaaaa tatacagaac atctattttg acatttagaa atcgagaaaa gtatatcagg
      661 ggtgaatatc gtttcgacca tgtgcattcc ctaagcaatc cacgcaaaat ggtgaaagtc
      721 tgggcagaga aagaattttc taatttaaag cgtctggaac aaggaggcgt ccgagcaccg
      781 cggccgattt tgtccggtgg tcatctgttg ttgatggaat tcctgggatc ggatggctgg
      841 gcggcaccca aacttaagga tgctgtactt acagattcaa aatcgagaac attgtatagg
      901 gaatgtattg aaattatgtg gaagatgtac aacaaatgca ggcttgttca tgctgaccta
      961 agcgaatata acatgctgta tcacaacgga tcgattgtag tcattgatgt ttcacaggct
     1021 gtagatcgtg atcattgtaa tgcaatggaa ttccttagaa atgactgtag caatattaca
     1081 acatttttca aaaagtacaa cgtgggagtt atgacgctcc aagcattgtt tgactttata
     1141 acagatccaa ctataaacga aaataacatg gacgaatatc tagatatacg gatgcaagag
     1201 ggaaatgatg aaaaagatcc acagcaacag gaagtagagg aggcagtttt taagcaagct
     1261 tacatacctc aaagattgac gcaggtgatt aatgtggaac gcgatataaa tctcgcgaaa
     1321 tctggaaaag atttgattta caagacattg ataggcttga aaacagactt atcgaagcct
     1381 gcagaaaaac cggagatcct tgctaataaa cacaaggcag ataacaaaag tacgaaggaa
     1441 gggagcgata tttatacctc ctccgaggag agtgacgatt cagatagcga aaacgaaaat
     1501 gaaacagaca gcgaggataa taagatcaaa tttgtaagct cggctaggcc tagaaacgaa
     1561 agtcccgaaa gtagaaaagc gcgcaagaag gcagtcaaag aacagcaggc ggagaagcgg
     1621 aaagtcaaga taaaaaagca cgtgaagaaa cgtaaaataa aagtatcaag aggaggaaaa
     1681 tgaatatttg tattt
//