Dbfetch

Dbfetch

LOCUS       XM_012202828             342 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes major royal jelly protein 4-like
            (LOC105621363), mRNA.
ACCESSION   XM_012202828
VERSION     XM_012202828.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq; corrected model.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130097.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts          :: corrected 1 indel
            internal stop codons :: corrected 1 genomic stop codon
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-159               ADTU01019111.1     260-418             c
            160-161             "NN"               1-2
            162-193             ADTU01019111.1     228-259             c
            194-342             ADTU01019110.1     718-866             c
FEATURES             Location/Qualifiers
     source          1..342
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..342
                     /gene="LOC105621363"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 2 bases in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:105621363"
     CDS             1..342
                     /gene="LOC105621363"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 2 bases in 1 codon;
                     substituted 1 base at 1 genomic stop codon"
                     /codon_start=1
                     /transl_except=(pos:103..105,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: major royal jelly protein
                     4-like"
                     /protein_id="XP_012058218.1"
                     /db_xref="GeneID:105621363"
                     /translation="MGHSLFVLPILFTAIVSFGLEVNIVHKWKHCQYEXESEQQKEDA
                     ISSSAYSSYXSIFIDAKRVNNGRIFVTTPREIDPSSPATLATVTDKSGSGSPLLHPYL
                     SCISAQEVYDI"
ORIGIN      
        1 atgggacatt ctctgtttgt cttaccaatt ctgttcaccg caattgtgag ctttggactc
       61 gaagtaaata ttgttcataa atggaaacat tgtcagtacg aatgagaaag tgaacagcag
      121 aaggaagatg cgataagttc tagcgcttac agctcctatn ngagcatatt tatcgatgca
      181 aaaagagtaa ataatggtag aatattcgtt actacgccaa gagaaattga ccctagttca
      241 cctgccactt tggcgacagt gactgataag tcaggatcag gaagtccact tctacatccg
      301 tatctatcat gtattagtgc tcaagaagtg tacgacatat ag
//