Dbfetch

LOCUS       XM_012202583            1506 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes probable cytochrome P450 6a14
            (LOC105621111), mRNA.
ACCESSION   XM_012202583
VERSION     XM_012202583.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Holometabola; Hymenoptera; Apocrita; Aculeata;
            Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130096.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1506
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..1506
                     /gene="LOC105621111"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 93 Proteins"
                     /db_xref="GeneID:105621111"
     CDS             1..1506
                     /gene="LOC105621111"
                     /codon_start=1
                     /product="probable cytochrome P450 6a14"
                     /protein_id="XP_012057973.1"
                     /db_xref="GeneID:105621111"
                     /translation="MIIVLVCLILGALIAFYFYLTRNYKYWQKRGIPCVDGALPGFGN
                     MLSVICMKTHIADFCCKIYKDNKGHSMVGIYDFTSPALIIIEPALIKMVLQTHFSSFA
                     ENAVHIDEESDSLLSYNPFGLSGEKWLNSRKRLTYAFSSMRLKILLESVKKVCATMEN
                     YMDKKLSNKETEFELKSLFSKYSAQVVAAAGFGVDGYCFDDDKKDISFRKLGQAIFKP
                     SKRSTIMFVLIFLIPSLNKILKQDLIPKHVDNFFRTLVADLMEQRRKDGIPRNDFLHL
                     MVEQERAEGDKFDIEMITGHAMSFIIDGYETSSSIMSFIGFHLAQYPDVQEKLREEVT
                     SVLNRYGGEITYEGLKDMTYMDQVFNETMRIMPAGALMKKRCTEEFELKGSDGVVCRV
                     QPGMEILIPLQALHTDPQYWENPEEYDPERFNSDRKHNIERFTFLPFGEGPRICVGMR
                     MAQLQIKAGLTMILRKYRMELSSRTQIPLKMILGTFLPSPKGGLWVYFRQL"
ORIGIN      
        1 atgatcatcg tgttggtgtg tctaattctc ggggctctta tagcttttta cttttatctg
       61 acgcgaaatt acaagtactg gcaaaaacgt ggaattccgt gcgtggatgg agccttgccg
      121 gggttcggta acatgttatc ggtaatctgc atgaagacgc acatcgctga tttctgttgc
      181 aagatttaca aggacaataa gggtcacagc atggttggga tctacgactt tacatcaccg
      241 gcgttaataa tcatcgaacc ggcactaata aaaatggtgc tgcaaaccca tttttcaagt
      301 tttgccgaaa atgctgttca tattgatgaa gaatcagata gtctcttatc atataatccc
      361 ttcggccttt ccggtgagaa gtggttaaac agtagaaagc gattgacata cgcattttcc
      421 agtatgcgac taaagatcct gctcgaaagc gtgaaaaaag tatgtgcgac tatggagaat
      481 tacatggaca aaaagttaag caacaaagag acagagttcg aactgaagag cttattttcc
      541 aaatattccg cgcaggtagt agctgctgct ggcttcggcg tagatggata ctgctttgat
      601 gatgacaaaa aagatatatc ttttagaaaa ctcggacaag ccatcttcaa accgtccaaa
      661 cgaagtacga ttatgtttgt tctcatattt ctcattccgt cattaaataa aatcttgaaa
      721 caagacctca ttccgaagca cgttgacaac ttcttcagga cattggttgc agaccttatg
      781 gaacaaagaa gaaaagacgg aatacctaga aacgattttc ttcatctgat ggtggaacag
      841 gagcgagcgg agggtgataa attcgatatt gaaatgatca cgggtcatgc gatgtcgttc
      901 attatcgacg gatatgagac gtctagtagt attatgagtt tcatcgggtt tcatttggct
      961 cagtacccag acgtacagga aaaattacgt gaagaagtga catctgtgct taacagatat
     1021 ggtggtgaaa tcacttacga aggcttgaaa gatatgacat atatggacca ggtcttcaac
     1081 gagacgatga gaataatgcc cgcaggggcg ctcatgaaga aacgatgcac agaagaattc
     1141 gaactaaaag gatccgatgg agttgtctgt cgcgtacaac ccggaatgga gatcctgata
     1201 ccgcttcaag ctctgcacac agatccacaa tactgggaaa atcccgaaga atatgatcct
     1261 gaaagattca attcagatag aaaacacaac attgagagat ttacttttct tcctttcggc
     1321 gaaggtccgc gaatctgcgt gggtatgaga atggctcagc tgcaaataaa ggcaggtttg
     1381 actatgattt tgagaaaata cagaatggaa ttatcgtcga ggacacaaat accattaaag
     1441 atgattcttg ggaccttttt accatcacca aaaggtggtc tatgggtcta tttccggcag
     1501 ctttaa
//