Dbfetch

Dbfetch

LOCUS       XM_012201846             588 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes N-acetyltransferase 9-like protein
            (LOC105620345), mRNA.
ACCESSION   XM_012201846
VERSION     XM_012201846.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130089.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 2% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..588
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..588
                     /gene="LOC105620345"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:105620345"
     CDS             1..588
                     /gene="LOC105620345"
                     /codon_start=1
                     /product="N-acetyltransferase 9-like protein"
                     /protein_id="XP_012057236.1"
                     /db_xref="GeneID:105620345"
                     /translation="MRKNMNTRISGTNIILVPYQEKHVIKYHEWMKNPILQYLTSSEP
                     LTLEEEFKMQKRWLEDEDKCTFIILDKHVYLTTKNEIDAMVGDTNLFLHDSQGLCVAE
                     IEIMIAEEVNRSKRRGWESIILMLLYGAETLNVNKFCAKIKLDNAVSIRMFEKLGFRE
                     EERSEVFREVTLEKKTSSNWTSWLHSELQSVIISN"
ORIGIN      
        1 atgagaaaaa atatgaatac tcgtatcagt ggaacaaata tcattttggt accgtatcaa
       61 gaaaagcatg ttataaaata tcatgaatgg atgaaaaatc ctattctgca atacttgaca
      121 agttcggagc cgttaacgct ggaggaagaa ttcaagatgc agaaacgttg gttggaggac
      181 gaggataaat gcacttttat tatattggac aaacatgttt acctgacaac caaaaatgaa
      241 atagatgcca tggtgggaga tacaaattta tttctgcacg actcacaggg actgtgcgtc
      301 gctgaaatag aaattatgat agcagaggaa gttaatcgaa gcaaaagaag aggctgggaa
      361 tctattatat taatgttact ctatggcgct gagacgctaa atgttaacaa attctgcgcc
      421 aaaatcaaat tagacaatgc ggtgagcata agaatgtttg agaaacttgg tttccgagag
      481 gaggaaagaa gtgaagtttt tcgagaagtt accctagaga agaaaacatc ttctaattgg
      541 acgagttggt tgcattctga attacaatct gttatcatat ctaattaa
//