Dbfetch

Dbfetch

LOCUS       XM_012200708             201 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes furin-like protease 2 (LOC105619181),
            mRNA.
ACCESSION   XM_012200708
VERSION     XM_012200708.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130083.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 10% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..201
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..201
                     /gene="LOC105619181"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:105619181"
     CDS             1..201
                     /gene="LOC105619181"
                     /codon_start=1
                     /product="furin-like protease 2"
                     /protein_id="XP_012056098.1"
                     /db_xref="GeneID:105619181"
                     /translation="MIFRVTLLVVCTLLAGARSEPRPRSRPVPIYSNQFAVYVPSGSE
                     TADEIAQEHGFDNHGQVEIYDI"
ORIGIN      
        1 atgatcttca gggtgacgtt gttggttgtg tgcacgctgc tggctggtgc gagatctgaa
       61 ccgagaccgc ggtcgcgacc agtgccgatc tattcgaatc agttcgccgt ttacgtaccc
      121 agcggatcgg agactgccga cgagatcgcc caggagcacg gcttcgacaa tcatggacag
      181 gtggaaatat acgatatata g
//