Dbfetch

Dbfetch

LOCUS       XM_001418506             873 bp    mRNA    linear   PLN 23-JUN-2017
DEFINITION  Ostreococcus lucimarinus CCE9901 predicted protein partial mRNA.
ACCESSION   XM_001418506
VERSION     XM_001418506.1
DBLINK      BioProject: PRJNA19407
            BioSample: SAMN03081420
KEYWORDS    RefSeq.
SOURCE      Ostreococcus lucimarinus CCE9901
  ORGANISM  Ostreococcus lucimarinus CCE9901
            Eukaryota; Viridiplantae; Chlorophyta; Mamiellophyceae;
            Mamiellales; Bathycoccaceae; Ostreococcus.
REFERENCE   1  (bases 1 to 873)
  AUTHORS   Palenik,B., Grimwood,J., Aerts,A., Rouze,P., Salamov,A., Putnam,N.,
            Dupont,C., Jorgensen,R., Derelle,E., Rombauts,S., Zhou,K.,
            Otillar,R., Merchant,S.S., Podell,S., Gaasterland,T., Napoli,C.,
            Gendler,K., Manuell,A., Tai,V., Vallon,O., Piganeau,G., Jancek,S.,
            Heijde,M., Jabbari,K., Bowler,C., Lohr,M., Robbens,S., Werner,G.,
            Dubchak,I., Pazour,G.J., Ren,Q., Paulsen,I., Delwiche,C.,
            Schmutz,J., Rokhsar,D., Van de Peer,Y., Moreau,H. and
            Grigoriev,I.V.
  TITLE     The tiny eukaryote Ostreococcus provides genomic insights into the
            paradox of plankton speciation
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 104 (18), 7705-7710 (2007)
   PUBMED   17460045
REFERENCE   2  (bases 1 to 873)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 873)
  AUTHORS   Grigoriev,I., Grimwood,J., Aerts,A., Salamov,A., Zhou,K., Lou,Y.,
            Pitluck,S., Schmutz,J., Myers,R.M., Lucas,S., Detter,J.C., Glavina
            del Rio,T., Putnam,N., Rokhsar,D. and Palenik,B.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (21-FEB-2007) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_009360).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..873
                     /organism="Ostreococcus lucimarinus CCE9901"
                     /mol_type="mRNA"
                     /strain="CCE9901"
                     /db_xref="taxon:436017"
                     /chromosome="6"
     gene            <1..>873
                     /locus_tag="OSTLU_12653"
                     /db_xref="GeneID:5002180"
     CDS             1..873
                     /locus_tag="OSTLU_12653"
                     /codon_start=1
                     /product="predicted protein"
                     /protein_id="XP_001418543.1"
                     /db_xref="GeneID:5002180"
                     /db_xref="InterPro:IPR007134"
                     /db_xref="InterPro:IPR007135"
                     /db_xref="JGIDB:Ost9901_3_12653"
                     /translation="MHALRHAVHGAYKTTMEAVTPIRSSSAFASEGVLTPEEFVAAGD
                     ALTRACPTWTWTTGQGARARTYLPREKQYLTTRRVPCARRARDVEAYAGAEEALTGED
                     EGWIATGAGGRSDGATMEAIPDLGAMTLEADAEDDAEDEYEDEDDDAVVLPTATAIAK
                     EAAGANGERDDENIVKTRTYDVSITYDKYYQTPRVWLNGYDENRLVLKPSKTLEDISA
                     DHAQKTVTIDPHPHTGVPSASIHPCKHASVMKKLVNSARAQSGEAPSVDSYMFVFLKF
                     IASVVPTIEYDYTL"
ORIGIN      
        1 atgcacgcgc tgcgacacgc ggtgcacggc gcgtacaaga cgacgatgga ggcggtgacg
       61 ccgattcggt cgtcgagcgc gttcgcgagc gagggcgtgc tgacgcccga ggagttcgtc
      121 gccgcggggg acgcgctgac gcgcgcgtgc ccgacgtgga cgtggacgac gggacagggc
      181 gcgcgcgcga ggacgtacct gccgcgggag aagcagtacc tgacgacgcg acgcgtgccg
      241 tgcgcgcgaa gagcgcgaga cgtcgaggcg tacgcgggcg cggaggaggc gctgacgggc
      301 gaggacgagg gatggatcgc gacgggggcg ggcgggagga gcgatggcgc gacgatggag
      361 gcgatcccgg atttgggggc gatgacgctc gaggcggacg cggaggacga cgcggaggac
      421 gaatacgaag acgaagacga cgacgcggtg gtcttaccga cggcgacggc gatcgcgaaa
      481 gaggcggcgg gggcgaacgg ggagagggac gatgaaaata tcgtcaagac gcgaacgtac
      541 gacgtgtcga tcacgtacga taaatactat caaacgccgc gcgtgtggtt gaacggatac
      601 gacgaaaaca gactggtgtt gaaaccttcg aaaacgttgg aagacatcag cgccgatcac
      661 gcgcaaaaga cggtgacgat cgatccgcat ccgcacaccg gcgtgccgtc ggcgtcgatt
      721 catccgtgca agcacgcgag cgtgatgaaa aagctcgtga attccgcgcg ggcgcaaagc
      781 ggcgaagcgc cgagcgtcga ttcctacatg ttcgtctttc tcaaattcat cgcgtccgtc
      841 gttccgacga tcgagtacga ttacactctg taa
//