Dbfetch

LOCUS       NM_001356641             744 bp    mRNA    linear   INV 21-AUG-2024
DEFINITION  Caenorhabditis elegans Glycoprotein (C35A11.3), partial mRNA.
ACCESSION   NM_001356641
VERSION     NM_001356641.1
DBLINK      BioProject: PRJNA158
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 744)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 744)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-AUG-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 744)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUL-2024) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 744)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..744
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>744
                     /gene="C35A11.3"
                     /locus_tag="CELE_C35A11.3"
                     /db_xref="GeneID:183228"
                     /db_xref="WormBase:WBGene00016430"
     CDS             1..744
                     /gene="C35A11.3"
                     /locus_tag="CELE_C35A11.3"
                     /standard_name="C35A11.3b"
                     /note="Predicted"
                     /codon_start=1
                     /product="Glycoprotein"
                     /protein_id="NP_001343825.1"
                     /db_xref="GeneID:183228"
                     /db_xref="WormBase:WBGene00016430"
                     /translation="MTSIHLLLLLTMCTPVAETNYQPSDPAPFDTFCTRETSTTTATE
                     STTVSTPTTATSSTPELSSSNSPSTETTTCASPTTSTNGHLTSTTDGAATSPIKTETP
                     KHQICFTPNQATFSRNSTLIQGTCITKPFTGYAMAIRRQDDLEERDYSKILTFKPIVF
                     YEKANETGPHLYLENHRGLNVIFVFYNNKKNVVILDASQKNNCANDKADCLPFEYRDI
                     NAFIYHICWDRDTHADGNFIDALLEKMLS"
ORIGIN      
        1 atgacttcta tccaccttct tctcctcctt accatgtgca ctcctgtcgc tgagacaaac
       61 taccagccaa gcgatccggc tccttttgac acgttctgta ctcgcgagac cagcacaacc
      121 acggcaacgg aatcaaccac tgtatccacg ccgaccaccg ccacgtcttc aactcctgaa
      181 ctctcctctt caaactcgcc atcgaccgaa actactacct gcgcttcgcc aactacttca
      241 acaaacggac acttgacttc tactactgat ggagctgcaa catctccaat caaaacagag
      301 actcctaaac atcagatatg ctttaccccg aaccaagcta ccttcagcag aaatagcacc
      361 ctgatccaag gcacgtgcat caccaagccg ttcactggat acgctatggc tatccggcgc
      421 caagatgacc tggaagaacg ggactactcg aagattctca ccttcaagcc aattgtgttc
      481 tatgagaagg ccaacgagac aggaccacac ttgtacttgg aaaaccaccg cgggctgaat
      541 gtgatcttcg tcttctacaa caacaagaag aacgtcgtca ttctggatgc aagtcagaaa
      601 aacaactgcg ccaacgacaa agccgattgc ctacccttcg agtaccggga catcaatgca
      661 ttcatatacc acatatgctg ggacagggac acgcatgcgg acggaaactt catcgatgct
      721 ttgcttgaga aaatgctgtc gtga
//