Dbfetch
LOCUS NM_001356641 744 bp mRNA linear INV 21-AUG-2024
DEFINITION Caenorhabditis elegans Glycoprotein (C35A11.3), partial mRNA.
ACCESSION NM_001356641
VERSION NM_001356641.1
DBLINK BioProject: PRJNA158
KEYWORDS RefSeq.
SOURCE Caenorhabditis elegans
ORGANISM Caenorhabditis elegans
Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
Caenorhabditis.
REFERENCE 1 (bases 1 to 744)
AUTHORS Sulson,J.E. and Waterston,R.
CONSRTM Caenorhabditis elegans Sequencing Consortium
TITLE Genome sequence of the nematode C. elegans: a platform for
investigating biology
JOURNAL Science 282 (5396), 2012-2018 (1998)
PUBMED 9851916
REMARK Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE 2 (bases 1 to 744)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (21-AUG-2024) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 744)
AUTHORS WormBase.
CONSRTM WormBase Consortium
TITLE Direct Submission
JOURNAL Submitted (26-JUL-2024) WormBase Group, European Bioinformatics
Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE 4 (bases 1 to 744)
AUTHORS Sulson,J.E. and Waterston,R.
TITLE Direct Submission
JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
at Washington University, St. Louis, MO 63110, USA
COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This
record is derived from an annotated genomic sequence (NC_003283).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..744
/organism="Caenorhabditis elegans"
/mol_type="mRNA"
/strain="Bristol N2"
/db_xref="taxon:6239"
/chromosome="V"
gene <1..>744
/gene="C35A11.3"
/locus_tag="CELE_C35A11.3"
/db_xref="GeneID:183228"
/db_xref="WormBase:WBGene00016430"
CDS 1..744
/gene="C35A11.3"
/locus_tag="CELE_C35A11.3"
/standard_name="C35A11.3b"
/note="Predicted"
/codon_start=1
/product="Glycoprotein"
/protein_id="NP_001343825.1"
/db_xref="GeneID:183228"
/db_xref="WormBase:WBGene00016430"
/translation="MTSIHLLLLLTMCTPVAETNYQPSDPAPFDTFCTRETSTTTATE
STTVSTPTTATSSTPELSSSNSPSTETTTCASPTTSTNGHLTSTTDGAATSPIKTETP
KHQICFTPNQATFSRNSTLIQGTCITKPFTGYAMAIRRQDDLEERDYSKILTFKPIVF
YEKANETGPHLYLENHRGLNVIFVFYNNKKNVVILDASQKNNCANDKADCLPFEYRDI
NAFIYHICWDRDTHADGNFIDALLEKMLS"
ORIGIN
1 atgacttcta tccaccttct tctcctcctt accatgtgca ctcctgtcgc tgagacaaac
61 taccagccaa gcgatccggc tccttttgac acgttctgta ctcgcgagac cagcacaacc
121 acggcaacgg aatcaaccac tgtatccacg ccgaccaccg ccacgtcttc aactcctgaa
181 ctctcctctt caaactcgcc atcgaccgaa actactacct gcgcttcgcc aactacttca
241 acaaacggac acttgacttc tactactgat ggagctgcaa catctccaat caaaacagag
301 actcctaaac atcagatatg ctttaccccg aaccaagcta ccttcagcag aaatagcacc
361 ctgatccaag gcacgtgcat caccaagccg ttcactggat acgctatggc tatccggcgc
421 caagatgacc tggaagaacg ggactactcg aagattctca ccttcaagcc aattgtgttc
481 tatgagaagg ccaacgagac aggaccacac ttgtacttgg aaaaccaccg cgggctgaat
541 gtgatcttcg tcttctacaa caacaagaag aacgtcgtca ttctggatgc aagtcagaaa
601 aacaactgcg ccaacgacaa agccgattgc ctacccttcg agtaccggga catcaatgca
661 ttcatatacc acatatgctg ggacagggac acgcatgcgg acggaaactt catcgatgct
721 ttgcttgaga aaatgctgtc gtga
//