Dbfetch
ID CAA23828; SV 1; linear; genomic DNA; STD; HUM; 333 BP. XX PA V00565.1 XX DT 03-NOV-1982 (Rel. 2, Created) DT 30-MAR-1995 (Rel. 43, Last updated, Version 6) XX DE Homo sapiens (human) preproinsulin XX KW . XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RX DOI; 10.1038/284026a0. RX PUBMED; 6243748. RA Bell G.I., Pictet R.L., Rutter W.J., Cordell B., Tischer E., Goodman H.M.; RT "Sequence of the human insulin gene"; RL Nature 284(5751):26-32(1980). XX RN [2] RX DOI; 10.1126/science.6248962. RX PUBMED; 6248962. RA Ullrich A., Dull T.J., Gray A., Brosius J., Sures I.; RT "Genetic variation in the human insulin gene"; RL Science, e1252229 209(4456):612-615(1980). XX RN [4] RA Bell G.I.; RT ; RL Submitted (01-APR-1982) to the INSDC. XX DR MD5; 04e867b3978a39f6dd2e4bebf890dc6c. XX FH Key Location/Qualifiers FH FT source 1..333 FT /organism="Homo sapiens" FT /mol_type="genomic DNA" FT /db_xref="taxon:9606" FT CDS join(V00565.1:2424..2610,V00565.1:3397..3542) FT /product="preproinsulin" FT /db_xref="GOA:P01308" FT /db_xref="HGNC:HGNC:6081" FT /db_xref="InterPro:IPR004825" FT /db_xref="InterPro:IPR016179" FT /db_xref="InterPro:IPR022352" FT /db_xref="InterPro:IPR022353" FT /db_xref="InterPro:IPR036438" FT /db_xref="PDB:1A7F" FT /db_xref="PDB:1AI0" FT /db_xref="PDB:1AIY" FT /db_xref="PDB:1B9E" FT /db_xref="PDB:1BEN" FT /db_xref="PDB:1EFE" FT /db_xref="PDB:1EV3" FT /db_xref="PDB:1EV6" FT /db_xref="PDB:1EVR" FT /db_xref="PDB:1FU2" FT /db_xref="PDB:1FUB" FT /db_xref="PDB:1G7A" FT /db_xref="PDB:1G7B" FT /db_xref="PDB:1GUJ" FT /db_xref="PDB:1HIQ" FT /db_xref="PDB:1HIS" FT /db_xref="PDB:1HIT" FT /db_xref="PDB:1HLS" FT /db_xref="PDB:1HTV" FT /db_xref="PDB:1HUI" FT /db_xref="PDB:1IOG" FT /db_xref="PDB:1IOH" FT /db_xref="PDB:1J73" FT /db_xref="PDB:1JCA" FT /db_xref="PDB:1JCO" FT /db_xref="PDB:1JK8" FT /db_xref="PDB:1K3M" FT /db_xref="PDB:1KMF" FT /db_xref="PDB:1LKQ" FT /db_xref="PDB:1LPH" FT /db_xref="PDB:1MHI" FT /db_xref="PDB:1MHJ" FT /db_xref="PDB:1MSO" FT /db_xref="PDB:1OS3" FT /db_xref="PDB:1OS4" FT /db_xref="PDB:1Q4V" FT /db_xref="PDB:1QIY" FT /db_xref="PDB:1QIZ" FT /db_xref="PDB:1QJ0" FT /db_xref="PDB:1RWE" FT /db_xref="PDB:1SF1" FT /db_xref="PDB:1SJT" FT /db_xref="PDB:1SJU" FT /db_xref="PDB:1T0C" FT /db_xref="PDB:1T1K" FT /db_xref="PDB:1T1P" FT /db_xref="PDB:1T1Q" FT /db_xref="PDB:1TRZ" FT /db_xref="PDB:1TYL" FT /db_xref="PDB:1TYM" FT /db_xref="PDB:1UZ9" FT /db_xref="PDB:1VKT" FT /db_xref="PDB:1W8P" FT /db_xref="PDB:1XDA" FT /db_xref="PDB:1XGL" FT /db_xref="PDB:1XW7" FT /db_xref="PDB:1ZEG" FT /db_xref="PDB:1ZEH" FT /db_xref="PDB:1ZNJ" FT /db_xref="PDB:2AIY" FT /db_xref="PDB:2C8Q" FT /db_xref="PDB:2C8R" FT /db_xref="PDB:2CEU" FT /db_xref="PDB:2G54" FT /db_xref="PDB:2G56" FT /db_xref="PDB:2H67" FT /db_xref="PDB:2HH4" FT /db_xref="PDB:2HHO" FT /db_xref="PDB:2HIU" FT /db_xref="PDB:2JMN" FT /db_xref="PDB:2JUM" FT /db_xref="PDB:2JUU" FT /db_xref="PDB:2JUV" FT /db_xref="PDB:2JV1" FT /db_xref="PDB:2JZQ" FT /db_xref="PDB:2K91" FT /db_xref="PDB:2K9R" FT /db_xref="PDB:2KJJ" FT /db_xref="PDB:2KJU" FT /db_xref="PDB:2KQP" FT /db_xref="PDB:2KQQ" FT /db_xref="PDB:2KXK" FT /db_xref="PDB:2L1Y" FT /db_xref="PDB:2L1Z" FT /db_xref="PDB:2LGB" FT /db_xref="PDB:2LWZ" FT /db_xref="PDB:2M1D" FT /db_xref="PDB:2M1E" FT /db_xref="PDB:2M2M" FT /db_xref="PDB:2M2N" FT /db_xref="PDB:2M2O" FT /db_xref="PDB:2M2P" FT /db_xref="PDB:2MLI" FT /db_xref="PDB:2MPG" FT /db_xref="PDB:2MPI" FT /db_xref="PDB:2MVC" FT /db_xref="PDB:2MVD" FT /db_xref="PDB:2N2V" FT /db_xref="PDB:2N2W" FT /db_xref="PDB:2N2X" FT /db_xref="PDB:2OLY" FT /db_xref="PDB:2OLZ" FT /db_xref="PDB:2OM0" FT /db_xref="PDB:2OM1" FT /db_xref="PDB:2OMG" FT /db_xref="PDB:2OMH" FT /db_xref="PDB:2OMI" FT /db_xref="PDB:2OMQ" FT /db_xref="PDB:2QIU" FT /db_xref="PDB:2R34" FT /db_xref="PDB:2R35" FT /db_xref="PDB:2R36" FT /db_xref="PDB:2RN5" FT /db_xref="PDB:2VJZ" FT /db_xref="PDB:2VK0" FT /db_xref="PDB:2W44" FT /db_xref="PDB:2WBY" FT /db_xref="PDB:2WC0" FT /db_xref="PDB:2WRU" FT /db_xref="PDB:2WRV" FT /db_xref="PDB:2WRW" FT /db_xref="PDB:2WRX" FT /db_xref="PDB:2WS0" FT /db_xref="PDB:2WS1" FT /db_xref="PDB:2WS4" FT /db_xref="PDB:2WS6" FT /db_xref="PDB:2WS7" FT /db_xref="PDB:3AIY" FT /db_xref="PDB:3BXQ" FT /db_xref="PDB:3E7Y" FT /db_xref="PDB:3E7Z" FT /db_xref="PDB:3EXX" FT /db_xref="PDB:3FQ9" FT /db_xref="PDB:3HYD" FT /db_xref="PDB:3I3Z" FT /db_xref="PDB:3I40" FT /db_xref="PDB:3ILG" FT /db_xref="PDB:3INC" FT /db_xref="PDB:3IR0" FT /db_xref="PDB:3JSD" FT /db_xref="PDB:3KQ6" FT /db_xref="PDB:3P2X" FT /db_xref="PDB:3P33" FT /db_xref="PDB:3Q6E" FT /db_xref="PDB:3ROV" FT /db_xref="PDB:3TT8" FT /db_xref="PDB:3U4N" FT /db_xref="PDB:3UTQ" FT /db_xref="PDB:3UTS" FT /db_xref="PDB:3UTT" FT /db_xref="PDB:3V19" FT /db_xref="PDB:3V1G" FT /db_xref="PDB:3W11" FT /db_xref="PDB:3W12" FT /db_xref="PDB:3W13" FT /db_xref="PDB:3W7Y" FT /db_xref="PDB:3W7Z" FT /db_xref="PDB:3W80" FT /db_xref="PDB:3ZI3" FT /db_xref="PDB:3ZQR" FT /db_xref="PDB:3ZS2" FT /db_xref="PDB:3ZU1" FT /db_xref="PDB:4AIY" FT /db_xref="PDB:4AJX" FT /db_xref="PDB:4AJZ" FT /db_xref="PDB:4AK0" FT /db_xref="PDB:4AKJ" FT /db_xref="PDB:4CXL" FT /db_xref="PDB:4CXN" FT /db_xref="PDB:4CY7" FT /db_xref="PDB:4EFX" FT /db_xref="PDB:4EWW" FT /db_xref="PDB:4EWX" FT /db_xref="PDB:4EWZ" FT /db_xref="PDB:4EX0" FT /db_xref="PDB:4EX1" FT /db_xref="PDB:4EXX" FT /db_xref="PDB:4EY1" FT /db_xref="PDB:4EY9" FT /db_xref="PDB:4EYD" FT /db_xref="PDB:4EYN" FT /db_xref="PDB:4EYP" FT /db_xref="PDB:4F0N" FT /db_xref="PDB:4F0O" FT /db_xref="PDB:4F1A" FT /db_xref="PDB:4F1B" FT /db_xref="PDB:4F1C" FT /db_xref="PDB:4F1D" FT /db_xref="PDB:4F1F" FT /db_xref="PDB:4F1G" FT /db_xref="PDB:4F4T" FT /db_xref="PDB:4F4V" FT /db_xref="PDB:4F51" FT /db_xref="PDB:4F8F" FT /db_xref="PDB:4FG3" FT /db_xref="PDB:4FKA" FT /db_xref="PDB:4GBC" FT /db_xref="PDB:4GBI" FT /db_xref="PDB:4GBK" FT /db_xref="PDB:4GBL" FT /db_xref="PDB:4GBN" FT /db_xref="PDB:4IUZ" FT /db_xref="PDB:4IYD" FT /db_xref="PDB:4IYF" FT /db_xref="PDB:4NIB" FT /db_xref="PDB:4OGA" FT /db_xref="PDB:4P65" FT /db_xref="PDB:4RXW" FT /db_xref="PDB:4UNE" FT /db_xref="PDB:4UNG" FT /db_xref="PDB:4UNH" FT /db_xref="PDB:4WDI" FT /db_xref="PDB:4XC4" FT /db_xref="PDB:4Y19" FT /db_xref="PDB:4Y1A" FT /db_xref="PDB:4Z76" FT /db_xref="PDB:4Z77" FT /db_xref="PDB:4Z78" FT /db_xref="PDB:5AIY" FT /db_xref="PDB:5BOQ" FT /db_xref="PDB:5BPO" FT /db_xref="PDB:5BQQ" FT /db_xref="PDB:5BTS" FT /db_xref="PDB:5C0D" FT /db_xref="PDB:5CJO" FT /db_xref="PDB:5CNY" FT /db_xref="PDB:5CO2" FT /db_xref="PDB:5CO6" FT /db_xref="PDB:5CO9" FT /db_xref="PDB:5E7W" FT /db_xref="PDB:5EMS" FT /db_xref="PDB:5EN9" FT /db_xref="PDB:5ENA" FT /db_xref="PDB:5HPR" FT /db_xref="PDB:5HPU" FT /db_xref="PDB:5HQI" FT /db_xref="PDB:5HRQ" FT /db_xref="PDB:5HYJ" FT /db_xref="PDB:5MAM" FT /db_xref="PDB:5MHD" FT /db_xref="PDB:5MT3" FT /db_xref="PDB:5MT9" FT /db_xref="PDB:5MWQ" FT /db_xref="PDB:5T7R" FT /db_xref="PDB:5UDP" FT /db_xref="PDB:5UOZ" FT /db_xref="PDB:5UQA" FT /db_xref="PDB:5URT" FT /db_xref="PDB:5URU" FT /db_xref="PDB:5USP" FT /db_xref="PDB:5USS" FT /db_xref="PDB:5USV" FT /db_xref="PDB:5UU2" FT /db_xref="PDB:5UU3" FT /db_xref="PDB:5UU4" FT /db_xref="PDB:5VIZ" FT /db_xref="PDB:5WBT" FT /db_xref="PDB:5WDM" FT /db_xref="PDB:5WOB" FT /db_xref="PDB:6B3Q" FT /db_xref="PDB:6B70" FT /db_xref="PDB:6BFC" FT /db_xref="PDB:6CE7" FT /db_xref="PDB:6CE9" FT /db_xref="PDB:6CEB" FT /db_xref="PDB:6CK2" FT /db_xref="PDB:6GNQ" FT /db_xref="PDB:6GV0" FT /db_xref="PDB:6HN5" FT /db_xref="PDB:6P4Z" FT /db_xref="PDB:6S34" FT /db_xref="UniProtKB/Swiss-Prot:P01308" FT /protein_id="CAA23828.1" FT /translation="MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGE FT RGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQ FT LENYCN" XX SQ Sequence 333 BP; 57 A; 106 C; 109 G; 61 T; 0 other; atggccctgt ggatgcgcct cctgcccctg ctggcgctgc tggccctctg gggacctgac 60 ccagccgcag cctttgtgaa ccaacacctg tgcggctcac acctggtgga agctctctac 120 ctagtgtgcg gggaacgagg cttcttctac acacccaaga cccgccggga ggcagaggac 180 ctgcaggtgg ggcaggtgga gctgggcggg ggccctggtg caggcagcct gcagcccttg 240 gccctggagg ggtccctgca gaagcgtggc attgtggaac aatgctgtac cagcatctgc 300 tccctctacc agctggagaa ctactgcaac tag 333 //