Dbfetch

ID   CAA23828; SV 1; linear; genomic DNA; STD; HUM; 333 BP.
XX
PA   V00565.1
XX
DT   03-NOV-1982 (Rel. 2, Created)
DT   30-MAR-1995 (Rel. 43, Last updated, Version 6)
XX
DE   Homo sapiens (human) preproinsulin
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1038/284026a0.
RX   PUBMED; 6243748.
RA   Bell G.I., Pictet R.L., Rutter W.J., Cordell B., Tischer E., Goodman H.M.;
RT   "Sequence of the human insulin gene";
RL   Nature 284(5751):26-32(1980).
XX
RN   [2]
RX   DOI; 10.1126/science.6248962.
RX   PUBMED; 6248962.
RA   Ullrich A., Dull T.J., Gray A., Brosius J., Sures I.;
RT   "Genetic variation in the human insulin gene";
RL   Science, e1252229 209(4456):612-615(1980).
XX
RN   [4]
RA   Bell G.I.;
RT   ;
RL   Submitted (01-APR-1982) to the INSDC.
XX
DR   MD5; 04e867b3978a39f6dd2e4bebf890dc6c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..333
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(V00565.1:2424..2610,V00565.1:3397..3542)
FT                   /product="preproinsulin"
FT                   /db_xref="GOA:P01308"
FT                   /db_xref="HGNC:HGNC:6081"
FT                   /db_xref="InterPro:IPR004825"
FT                   /db_xref="InterPro:IPR016179"
FT                   /db_xref="InterPro:IPR022352"
FT                   /db_xref="InterPro:IPR022353"
FT                   /db_xref="InterPro:IPR036438"
FT                   /db_xref="PDB:1A7F"
FT                   /db_xref="PDB:1AI0"
FT                   /db_xref="PDB:1AIY"
FT                   /db_xref="PDB:1B9E"
FT                   /db_xref="PDB:1BEN"
FT                   /db_xref="PDB:1EFE"
FT                   /db_xref="PDB:1EV3"
FT                   /db_xref="PDB:1EV6"
FT                   /db_xref="PDB:1EVR"
FT                   /db_xref="PDB:1FU2"
FT                   /db_xref="PDB:1FUB"
FT                   /db_xref="PDB:1G7A"
FT                   /db_xref="PDB:1G7B"
FT                   /db_xref="PDB:1GUJ"
FT                   /db_xref="PDB:1HIQ"
FT                   /db_xref="PDB:1HIS"
FT                   /db_xref="PDB:1HIT"
FT                   /db_xref="PDB:1HLS"
FT                   /db_xref="PDB:1HTV"
FT                   /db_xref="PDB:1HUI"
FT                   /db_xref="PDB:1IOG"
FT                   /db_xref="PDB:1IOH"
FT                   /db_xref="PDB:1J73"
FT                   /db_xref="PDB:1JCA"
FT                   /db_xref="PDB:1JCO"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1K3M"
FT                   /db_xref="PDB:1KMF"
FT                   /db_xref="PDB:1LKQ"
FT                   /db_xref="PDB:1LPH"
FT                   /db_xref="PDB:1MHI"
FT                   /db_xref="PDB:1MHJ"
FT                   /db_xref="PDB:1MSO"
FT                   /db_xref="PDB:1OS3"
FT                   /db_xref="PDB:1OS4"
FT                   /db_xref="PDB:1Q4V"
FT                   /db_xref="PDB:1QIY"
FT                   /db_xref="PDB:1QIZ"
FT                   /db_xref="PDB:1QJ0"
FT                   /db_xref="PDB:1RWE"
FT                   /db_xref="PDB:1SF1"
FT                   /db_xref="PDB:1SJT"
FT                   /db_xref="PDB:1SJU"
FT                   /db_xref="PDB:1T0C"
FT                   /db_xref="PDB:1T1K"
FT                   /db_xref="PDB:1T1P"
FT                   /db_xref="PDB:1T1Q"
FT                   /db_xref="PDB:1TRZ"
FT                   /db_xref="PDB:1TYL"
FT                   /db_xref="PDB:1TYM"
FT                   /db_xref="PDB:1UZ9"
FT                   /db_xref="PDB:1VKT"
FT                   /db_xref="PDB:1W8P"
FT                   /db_xref="PDB:1XDA"
FT                   /db_xref="PDB:1XGL"
FT                   /db_xref="PDB:1XW7"
FT                   /db_xref="PDB:1ZEG"
FT                   /db_xref="PDB:1ZEH"
FT                   /db_xref="PDB:1ZNJ"
FT                   /db_xref="PDB:2AIY"
FT                   /db_xref="PDB:2C8Q"
FT                   /db_xref="PDB:2C8R"
FT                   /db_xref="PDB:2CEU"
FT                   /db_xref="PDB:2G54"
FT                   /db_xref="PDB:2G56"
FT                   /db_xref="PDB:2H67"
FT                   /db_xref="PDB:2HH4"
FT                   /db_xref="PDB:2HHO"
FT                   /db_xref="PDB:2HIU"
FT                   /db_xref="PDB:2JMN"
FT                   /db_xref="PDB:2JUM"
FT                   /db_xref="PDB:2JUU"
FT                   /db_xref="PDB:2JUV"
FT                   /db_xref="PDB:2JV1"
FT                   /db_xref="PDB:2JZQ"
FT                   /db_xref="PDB:2K91"
FT                   /db_xref="PDB:2K9R"
FT                   /db_xref="PDB:2KJJ"
FT                   /db_xref="PDB:2KJU"
FT                   /db_xref="PDB:2KQP"
FT                   /db_xref="PDB:2KQQ"
FT                   /db_xref="PDB:2KXK"
FT                   /db_xref="PDB:2L1Y"
FT                   /db_xref="PDB:2L1Z"
FT                   /db_xref="PDB:2LGB"
FT                   /db_xref="PDB:2LWZ"
FT                   /db_xref="PDB:2M1D"
FT                   /db_xref="PDB:2M1E"
FT                   /db_xref="PDB:2M2M"
FT                   /db_xref="PDB:2M2N"
FT                   /db_xref="PDB:2M2O"
FT                   /db_xref="PDB:2M2P"
FT                   /db_xref="PDB:2MLI"
FT                   /db_xref="PDB:2MPG"
FT                   /db_xref="PDB:2MPI"
FT                   /db_xref="PDB:2MVC"
FT                   /db_xref="PDB:2MVD"
FT                   /db_xref="PDB:2N2V"
FT                   /db_xref="PDB:2N2W"
FT                   /db_xref="PDB:2N2X"
FT                   /db_xref="PDB:2OLY"
FT                   /db_xref="PDB:2OLZ"
FT                   /db_xref="PDB:2OM0"
FT                   /db_xref="PDB:2OM1"
FT                   /db_xref="PDB:2OMG"
FT                   /db_xref="PDB:2OMH"
FT                   /db_xref="PDB:2OMI"
FT                   /db_xref="PDB:2OMQ"
FT                   /db_xref="PDB:2QIU"
FT                   /db_xref="PDB:2R34"
FT                   /db_xref="PDB:2R35"
FT                   /db_xref="PDB:2R36"
FT                   /db_xref="PDB:2RN5"
FT                   /db_xref="PDB:2VJZ"
FT                   /db_xref="PDB:2VK0"
FT                   /db_xref="PDB:2W44"
FT                   /db_xref="PDB:2WBY"
FT                   /db_xref="PDB:2WC0"
FT                   /db_xref="PDB:2WRU"
FT                   /db_xref="PDB:2WRV"
FT                   /db_xref="PDB:2WRW"
FT                   /db_xref="PDB:2WRX"
FT                   /db_xref="PDB:2WS0"
FT                   /db_xref="PDB:2WS1"
FT                   /db_xref="PDB:2WS4"
FT                   /db_xref="PDB:2WS6"
FT                   /db_xref="PDB:2WS7"
FT                   /db_xref="PDB:3AIY"
FT                   /db_xref="PDB:3BXQ"
FT                   /db_xref="PDB:3E7Y"
FT                   /db_xref="PDB:3E7Z"
FT                   /db_xref="PDB:3EXX"
FT                   /db_xref="PDB:3FQ9"
FT                   /db_xref="PDB:3HYD"
FT                   /db_xref="PDB:3I3Z"
FT                   /db_xref="PDB:3I40"
FT                   /db_xref="PDB:3ILG"
FT                   /db_xref="PDB:3INC"
FT                   /db_xref="PDB:3IR0"
FT                   /db_xref="PDB:3JSD"
FT                   /db_xref="PDB:3KQ6"
FT                   /db_xref="PDB:3P2X"
FT                   /db_xref="PDB:3P33"
FT                   /db_xref="PDB:3Q6E"
FT                   /db_xref="PDB:3ROV"
FT                   /db_xref="PDB:3TT8"
FT                   /db_xref="PDB:3U4N"
FT                   /db_xref="PDB:3UTQ"
FT                   /db_xref="PDB:3UTS"
FT                   /db_xref="PDB:3UTT"
FT                   /db_xref="PDB:3V19"
FT                   /db_xref="PDB:3V1G"
FT                   /db_xref="PDB:3W11"
FT                   /db_xref="PDB:3W12"
FT                   /db_xref="PDB:3W13"
FT                   /db_xref="PDB:3W7Y"
FT                   /db_xref="PDB:3W7Z"
FT                   /db_xref="PDB:3W80"
FT                   /db_xref="PDB:3ZI3"
FT                   /db_xref="PDB:3ZQR"
FT                   /db_xref="PDB:3ZS2"
FT                   /db_xref="PDB:3ZU1"
FT                   /db_xref="PDB:4AIY"
FT                   /db_xref="PDB:4AJX"
FT                   /db_xref="PDB:4AJZ"
FT                   /db_xref="PDB:4AK0"
FT                   /db_xref="PDB:4AKJ"
FT                   /db_xref="PDB:4CXL"
FT                   /db_xref="PDB:4CXN"
FT                   /db_xref="PDB:4CY7"
FT                   /db_xref="PDB:4EFX"
FT                   /db_xref="PDB:4EWW"
FT                   /db_xref="PDB:4EWX"
FT                   /db_xref="PDB:4EWZ"
FT                   /db_xref="PDB:4EX0"
FT                   /db_xref="PDB:4EX1"
FT                   /db_xref="PDB:4EXX"
FT                   /db_xref="PDB:4EY1"
FT                   /db_xref="PDB:4EY9"
FT                   /db_xref="PDB:4EYD"
FT                   /db_xref="PDB:4EYN"
FT                   /db_xref="PDB:4EYP"
FT                   /db_xref="PDB:4F0N"
FT                   /db_xref="PDB:4F0O"
FT                   /db_xref="PDB:4F1A"
FT                   /db_xref="PDB:4F1B"
FT                   /db_xref="PDB:4F1C"
FT                   /db_xref="PDB:4F1D"
FT                   /db_xref="PDB:4F1F"
FT                   /db_xref="PDB:4F1G"
FT                   /db_xref="PDB:4F4T"
FT                   /db_xref="PDB:4F4V"
FT                   /db_xref="PDB:4F51"
FT                   /db_xref="PDB:4F8F"
FT                   /db_xref="PDB:4FG3"
FT                   /db_xref="PDB:4FKA"
FT                   /db_xref="PDB:4GBC"
FT                   /db_xref="PDB:4GBI"
FT                   /db_xref="PDB:4GBK"
FT                   /db_xref="PDB:4GBL"
FT                   /db_xref="PDB:4GBN"
FT                   /db_xref="PDB:4IUZ"
FT                   /db_xref="PDB:4IYD"
FT                   /db_xref="PDB:4IYF"
FT                   /db_xref="PDB:4NIB"
FT                   /db_xref="PDB:4OGA"
FT                   /db_xref="PDB:4P65"
FT                   /db_xref="PDB:4RXW"
FT                   /db_xref="PDB:4UNE"
FT                   /db_xref="PDB:4UNG"
FT                   /db_xref="PDB:4UNH"
FT                   /db_xref="PDB:4WDI"
FT                   /db_xref="PDB:4XC4"
FT                   /db_xref="PDB:4Y19"
FT                   /db_xref="PDB:4Y1A"
FT                   /db_xref="PDB:4Z76"
FT                   /db_xref="PDB:4Z77"
FT                   /db_xref="PDB:4Z78"
FT                   /db_xref="PDB:5AIY"
FT                   /db_xref="PDB:5BOQ"
FT                   /db_xref="PDB:5BPO"
FT                   /db_xref="PDB:5BQQ"
FT                   /db_xref="PDB:5BTS"
FT                   /db_xref="PDB:5C0D"
FT                   /db_xref="PDB:5CJO"
FT                   /db_xref="PDB:5CNY"
FT                   /db_xref="PDB:5CO2"
FT                   /db_xref="PDB:5CO6"
FT                   /db_xref="PDB:5CO9"
FT                   /db_xref="PDB:5E7W"
FT                   /db_xref="PDB:5EMS"
FT                   /db_xref="PDB:5EN9"
FT                   /db_xref="PDB:5ENA"
FT                   /db_xref="PDB:5HPR"
FT                   /db_xref="PDB:5HPU"
FT                   /db_xref="PDB:5HQI"
FT                   /db_xref="PDB:5HRQ"
FT                   /db_xref="PDB:5HYJ"
FT                   /db_xref="PDB:5MAM"
FT                   /db_xref="PDB:5MHD"
FT                   /db_xref="PDB:5MT3"
FT                   /db_xref="PDB:5MT9"
FT                   /db_xref="PDB:5MWQ"
FT                   /db_xref="PDB:5T7R"
FT                   /db_xref="PDB:5UDP"
FT                   /db_xref="PDB:5UOZ"
FT                   /db_xref="PDB:5UQA"
FT                   /db_xref="PDB:5URT"
FT                   /db_xref="PDB:5URU"
FT                   /db_xref="PDB:5USP"
FT                   /db_xref="PDB:5USS"
FT                   /db_xref="PDB:5USV"
FT                   /db_xref="PDB:5UU2"
FT                   /db_xref="PDB:5UU3"
FT                   /db_xref="PDB:5UU4"
FT                   /db_xref="PDB:5VIZ"
FT                   /db_xref="PDB:5WBT"
FT                   /db_xref="PDB:5WDM"
FT                   /db_xref="PDB:5WOB"
FT                   /db_xref="PDB:6B3Q"
FT                   /db_xref="PDB:6B70"
FT                   /db_xref="PDB:6BFC"
FT                   /db_xref="PDB:6CE7"
FT                   /db_xref="PDB:6CE9"
FT                   /db_xref="PDB:6CEB"
FT                   /db_xref="PDB:6CK2"
FT                   /db_xref="PDB:6GNQ"
FT                   /db_xref="PDB:6GV0"
FT                   /db_xref="PDB:6HN5"
FT                   /db_xref="PDB:6P4Z"
FT                   /db_xref="PDB:6S34"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01308"
FT                   /protein_id="CAA23828.1"
FT                   /translation="MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGE
FT                   RGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQ
FT                   LENYCN"
XX
SQ   Sequence 333 BP; 57 A; 106 C; 109 G; 61 T; 0 other;
     atggccctgt ggatgcgcct cctgcccctg ctggcgctgc tggccctctg gggacctgac        60
     ccagccgcag cctttgtgaa ccaacacctg tgcggctcac acctggtgga agctctctac       120
     ctagtgtgcg gggaacgagg cttcttctac acacccaaga cccgccggga ggcagaggac       180
     ctgcaggtgg ggcaggtgga gctgggcggg ggccctggtg caggcagcct gcagcccttg       240
     gccctggagg ggtccctgca gaagcgtggc attgtggaac aatgctgtac cagcatctgc       300
     tccctctacc agctggagaa ctactgcaac tag                                    333
//