Dbfetch

ID   AL731825; SV 1; circular; genomic DNA; STD; PRO; 127923 BP.
XX
AC   AL731825;
XX
DT   01-JUL-2002 (Rel. 72, Created)
DT   23-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Bacillus thuringiensis subsp. israelensis plasmid pBtoxis
XX
KW   .
XX
OS   Bacillus thuringiensis serovar israelensis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
XX
RN   [1]
RP   1-127923
RX   DOI; 10.1128/AEM.68.10.5082-5095.2002.
RX   PUBMED; 12324359.
RA   Berry C., O'Niel S., Ben-Dov E., Jones A.F., Murphy L., Quail M.A.,
RA   Harris D., Zaritsky A., Parkhill J.;
RT   "Complete sequence and organization of pBtoxis, the toxin-coding plasmid of
RT   Bacillus thuringiensis subsp. israelensis";
RL   Appl. Environ. Microbiol. 68(10):5082-5095(2002).
XX
RN   [2]
RP   1-127923
RA   Parkhill J.;
RT   ;
RL   Submitted (19-APR-2002) to the INSDC.
RL   Submitted on behalf of the pBtoxis sequencing team, Sanger Centre, Wellcome
RL   Trust Genome Campus, Hinxton, Cambridge CB10 1SA E-mail:
RL   parkhill@sanger.ac.uk
XX
DR   MD5; 73ee2c18a355a49024a0f4add9518d2e.
DR   EuropePMC; PMC126441; 12324359.
DR   EuropePMC; PMC1459170; 16512902.
DR   EuropePMC; PMC1626470; 17059605.
DR   EuropePMC; PMC2708434; 19465527.
DR   EuropePMC; PMC3127610; 21498758.
DR   EuropePMC; PMC3294862; 22210770.
DR   EuropePMC; PMC3448730; 23029407.
DR   EuropePMC; PMC3563526; 23390547.
XX
CC   Notes:
CC   Details of pBtoxis sequencing at the Sanger Centre
CC   are available on the World Wide Web.
CC   (URL, http://www.sanger.ac.uk/Projects/B_thuringiensis/)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..127923
FT                   /organism="Bacillus thuringiensis serovar israelensis"
FT                   /mol_type="genomic DNA"
FT                   /note="plasmid pBtoxis"
FT                   /db_xref="taxon:1430"
FT   regulatory      1145..1149
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             1163..2089
FT                   /transl_table=11
FT                   /gene="pBt001"
FT                   /note="Similar in part to Bacillus anthracis pxo1-49
FT                   TR:Q9X319 (EMBL:AF065404) (227 aa) fasta scores: E():
FT                   8.9e-44, 78.48% id in 158 aa"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNX5"
FT                   /protein_id="CAD30064.1"
FT                   /translation="MSTHLNFSQQNFKVHGVKFFDGLFNIIKLENERKELPSSALATYI
FT                   MLHFECNDIGMLPREFQIMDLAKKSGIPYTTIYTGFQVCLERKLVREIPVGNRTVYEIV
FT                   DYALYNHTAAETTDMINISLSYFRIPFYLIQTTILSSLVKARDNRGIMILLELINTFSR
FT                   KIGMEHYKHKIEDFEITRKMAFLKEKLNRNAKKVRQYIEIVKPIKFNAVDLKDKKSSES
FT                   RITRVRRQVQQVIIEKFNVIFSSNCVIENDKKELHRPIAKCRKEAVSRLKHMGQALRKK
FT                   DKENIMTAFRQEIVDIEIYLPTKQKQN"
FT   repeat_region   complement(2246..2262)
FT                   /rpt_type=INVERTED
FT   repeat_region   2246..3106
FT                   /note="IS240"
FT   CDS             2337..3044
FT                   /transl_table=11
FT                   /gene="pBt003"
FT                   /product="insertion element IS240 protein"
FT                   /note="Similar to Bacillus thuringiensis insertion element
FT                   IS240-a protein TR:Q45766 (EMBL:M23740) (235 aa) fasta
FT                   scores: E(): 2.2e-92, 99.57% id in 235 aa, and to
FT                   Mycobacterium fortuitum, transposase tnp tnp6100 TR:Q49185
FT                   (EMBL:X53635) (254 aa) fasta scores: E(): 1.4e-37, 48.05%
FT                   id in 231 aa"
FT                   /db_xref="GOA:Q8KNX4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNX4"
FT                   /protein_id="CAD30065.1"
FT                   /translation="MEKENIFKWKHYQADMILWTVRWYLRYNLSFRDLVEMMEERGLSL
FT                   SHTTIMRWVHQYGPELNERIRKHLKRTNDSWRVDETYIKIKGENMYLYRAVDSEGNTLD
FT                   FYLSKKRDAKAAKCFLKKALASFHVTKPRVITVDGNKAYPVAIRELKNEKSIPYGMPLR
FT                   VKKYLNNMIEQDHRFIKKRILNMLGLKSMQTAVKMIAGIEAMHMVKKGQLKLRAQSAQN
FT                   QNRCIHQLFGLTA"
FT   misc_feature    2538..2933
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   3090..3106
FT                   /rpt_type=INVERTED
FT   repeat_region   complement(3521..3535)
FT                   /rpt_type=INVERTED
FT   repeat_region   3521..4381
FT                   /note="IS240"
FT   CDS             3612..4319
FT                   /transl_table=11
FT                   /gene="pBt004"
FT                   /product="insertion element IS240 protein"
FT                   /note="Similar to Bacillus thuringiensis insertion element
FT                   IS240-a protein TR:Q45766 (EMBL:M23740) (235 aa) fasta
FT                   scores: E(): 3.5e-91, 99.14% id in 235 aa, and to
FT                   Mycobacterium fortuitum, transposase tnpA or tnp6100
FT                   TR:Q49185 (EMBL:X53635) (254 aa) fasta scores: E():
FT                   1.1e-37, 48.05% id in 231 aa"
FT                   /db_xref="GOA:Q8KH55"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KH55"
FT                   /protein_id="CAD30066.1"
FT                   /translation="MEKENIFKWKHYQADMILWTVRWYLRYNLSFRDLVEMMEERGLSL
FT                   SHTTIMRWVHQYGPELNERIRKHLKRTNDSWRVDETYIKIKGENMYLYRAVDSEGNTLD
FT                   FYLSKKRDAKAAKCFLKKALASFHVTKPRVITVDGNKAYPVAIRELKNEKSIPYGMPLR
FT                   VKKYLNNMIEQDHRFIKKRIRNMLGLKSMQTAVKMIAGIEAMHMVKKGQLKLRAQSAQN
FT                   QNRCIHQLFGLTA"
FT   misc_feature    3813..4208
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   4365..4381
FT                   /rpt_type=INVERTED
FT   CDS             complement(4634..5275)
FT                   /transl_table=11
FT                   /gene="pBt005"
FT                   /product="integrase/recombinase family protein"
FT                   /note="Similar to N-terminus of Bacillus anthracis pxo1-18
FT                   TR:Q9X2Y9 (EMBL:AF065404) (315 aa) fasta scores: E():
FT                   4.2e-56, 84.15% id in 183 aa, and to Bacillus halodurans
FT                   Bh2364 protein TR:Q9KAC5 (EMBL:AP001515) (378 aa) fasta
FT                   scores: E(): 1.6e-18, 35.45% id in 189 aa, and weakly to
FT                   Lactobacillus delbrueckii integrase/recombinase orf2
FT                   TR:Q48538 (EMBL:Z50864) (333 aa) fasta scores: E(): 6.3,
FT                   28.88% id in 90 aa, and to Bacillus thuringiensis resolvase
FT                   tnpI SW:TNRI_BACTU (P10020) (284 aa) fasta scores: E():
FT                   8.5, 23.88% id in 180 aa"
FT                   /db_xref="GOA:Q8KNX3"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNX3"
FT                   /protein_id="CAD30067.1"
FT                   /translation="MSKNINLEETLAAFSAYLIEKGRKQSTIKRYAYDIKDFYKWLRAN
FT                   KKLLHIKSWSELSEADYQTYFSELEDKRKYSQKTRHRIWVVLKKLHMFLCIVSPLDGIN
FT                   LSLIPDQSLNDNDFITEMEEKLLKQTVLSTKGLTERQAKYRPLIMDRNVCIINLVVNYG
FT                   LSLQELVSLNMSHINFARNIWCYVKKIDTLNRDILFVKQLEIVAFHRTSF"
FT   misc_feature    complement(4985..5251)
FT                   /note="HMMPfam hit to PF02899, Phage integrase, N-terminal
FT                   SAM-like domain"
FT   regulatory      complement(5283..5286)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(5364..5507)
FT                   /transl_table=11
FT                   /gene="pBt006"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Bacillus anthracis pxo1-17 TR:Q9X2Y8
FT                   (EMBL:AF065404) (47 aa) fasta scores: E(): 2.1e-12, 68.08%
FT                   id in 47 aa"
FT                   /db_xref="GOA:Q8KNX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNX2"
FT                   /protein_id="CAD30068.1"
FT                   /translation="MAVLKDSNYIEMNTYNEIGFFKGIFWGLIFVVPFWSIMIATFIWL
FT                   CK"
FT   misc_feature    complement(5370..5435)
FT                   /note="1 probable transmembrane helix predicted for pBt006
FT                   by TMHMM2.0"
FT   regulatory      complement(5515..5519)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(6451..8160)
FT                   /transl_table=11
FT                   /gene="pBt007"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacillus anthracis pxo1-16 TR:Q9X2Y7
FT                   (EMBL:AF065404) (569 aa) fasta scores: E(): 0, 96.13% id in
FT                   569 aa, and to Bacillus thuringiensis pxo1 orf16-like
FT                   protein TR:CAC50562 (EMBL:AJ296638) (310 aa) fasta scores:
FT                   E(): 6.5e-122, 99.67% id in 310 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNX1"
FT                   /protein_id="CAD30069.1"
FT                   /translation="MGKSFIIQNQRSLNGKTTNAVVVTLKSWQKFVAAFEEKYYSYKDT
FT                   YLEDILQHMTYEERIADVEGFVEKAKPSFSRRAMSTLAEKTGRKHKLYGITNADLEVFL
FT                   YLHKKCFTNGVIPNVTIHMMWEDYKQYKEEFAYIQHSQFYIALKKLNLHNIISIENGLD
FT                   GRYTIKLTHFMNEETEKANPYVYISPVIFTKDFFKLSIAAKKLFLDIAMQQHTETTLKR
FT                   SLDKQDERGNKTHFGGMYRFLHKKYPHQIRAVIEELTTALPCTGNPLFKICKMQKGVKH
FT                   TKRYTTLYLSIHSDFLCSKEAGEEQHRDPFTPKATYARKAKFIEAVLQEMNIGELSADM
FT                   NKFIHVLKYTCHRQIRSVIRGLRDMVDRKEGYPTKIVYTLKKLLHQTSQYQILDTAAKE
FT                   GIYPLIAQHIPKERNSDREQAVFNFGLHYSMYSLHNIKRMFKNVHALLKQKFAVPVTEE
FT                   SYYRNYLKYQEETLFRKYAYDQGVNLHAYIALEIEMREKLKVRGHKERTIPSDVREWFI
FT                   EAIDKLPQEKLRVIELPKQFNLLEFMRTFERLVRAGVTITAPDQVLHAMEIK"
FT   regulatory      complement(8168..8173)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      8947..8951
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             8959..10653
FT                   /transl_table=11
FT                   /gene="pBt009"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacillus anthracis pxo1-14 TR:Q9X2Y5
FT                   (EMBL:AF065404) (564 aa) fasta scores: E(): 1.6e-191,
FT                   89.71% id in 564 aa, and to Bacillus thuringiensis pxo1
FT                   orf14-like protein TR:CAC50561 (EMBL:AJ296638) (280 aa)
FT                   fasta scores: E(): 1.3e-101, 99.28% id in 280 aa"
FT                   /db_xref="GOA:Q8KNX0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNX0"
FT                   /protein_id="CAD30070.1"
FT                   /translation="MEKLKVLFQNTLYIAYPLFTGVKGNDKILNKWQRFYQDVEKDLQK
FT                   IYNSTYSSQTFERLVKWVSKKEALGLSAIDILPKLDNHKEEIYECLRYDLLMEFGVKLP
FT                   VFTKELPLNSGPKSEYIERSNAGFMYHLSDTIAKNKFADDQDKEGRIAQLPDKQNSLVV
FT                   VSSRDDGDMKLQREELKKWNTLIDSTFLTRVMDDLTADCLDIVTELWVKSAENDKTIVP
FT                   VHYEQILDMCNMKQIKNGKTYYRKEDRLKIMERLAALASIFIYVNEDNEIVILNEEDPN
FT                   ETLAYKKQRIRRLFVMDEIIIAKDVDTDKTLGIESMNVTPGSFLSKYLYGSEKLTGLLS
FT                   KKALEYNSKQQRYHKRLTRYLSWRWRIQQSYQHLTHSYSIGGPKGVLQVMEISMKRKPS
FT                   LIRQVFEKTLDDLMRDQVIQEWKYSPEIDEEKCKGKNWFENYWLKLKIIISPTNELVKL
FT                   QQELIIKKSRKQVPFFIEIEGKQPVIEEETISILNQENPNSIEFYIEKMNTYKEKNNKS
FT                   IREFAKEIEISYSTLSRMLSGKRKRLNDDTKNKLDKWIERQEVVNLL"
FT   regulatory      11162..11168
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             11173..11412
FT                   /transl_table=11
FT                   /gene="pBt010"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNW9"
FT                   /protein_id="CAD30071.1"
FT                   /translation="MDTFRDKLRLGAIDINQNDKNGVFLRQFDEVRYKEEKYIIIWHPI
FT                   YEEFVASHHTRKFIPYELLNRVEYKKNLKENVPK"
FT   regulatory      11490..11493
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             11504..11989
FT                   /transl_table=11
FT                   /gene="pBt011"
FT                   /product="putative DNA-binding protein"
FT                   /note="Similar to Bacillus subtilis plasmid pPOD2000 ORF4
FT                   gene TR:Q45507 (EMBL:U55043) (110 aa) fasta scores: E():
FT                   1.9e-08, 41.48% id in 94 aa, and to Bacillus subtilis
FT                   pTA1040 orf2c_40 TR:Q45444 (EMBL:U32378) (157 aa) fasta
FT                   scores: E(): 0.72, 23.07% id in 169 aa. Contains potential
FT                   HTH motif at aa 6-27 Score 1076 (+2.85 SD)"
FT                   /db_xref="GOA:Q8KNW8"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNW8"
FT                   /protein_id="CAD30072.1"
FT                   /translation="MINNWMTIIEVEKVTEISYVIIRRYIRMHGHHLRVKKQGKNYLIS
FT                   KEYIHILLKIRLYYQEGKTTEQIEDVLCSVHILPKININENEKSMVLNVTETLIHMNSG
FT                   LNDLNRKYDGLLHEFEKQKEYIEDVLTKRQQKLLLKFQETEGFNSRQDKKWWKLWRL"
FT   regulatory      14193..14196
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             14204..14824
FT                   /transl_table=11
FT                   /gene="pBt013"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="InterPro:IPR025855"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNW7"
FT                   /protein_id="CAD30073.1"
FT                   /translation="MVLRSRDKKIIQALDLFKCMTRDQIVRLLFSDVKNPITSANFVLK
FT                   RLRRDGYIDAKIDEQPYIYFPEPSSVKKTSQKIKHYLAIVDFYIGICQYKSPSVFVVEK
FT                   RFGSGYIQPDIFMVWNKMAFFVEIQLSRYSSDLMKNKLKRYINYFGAEEWNFKNKTYEL
FT                   STSPYVWIVSKSPYAISEEKLQIIQTSRAEGILHNKTISIKHG"
FT   regulatory      14958..14963
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             14972..15346
FT                   /transl_table=11
FT                   /gene="pBt014"
FT                   /product="probable transcriptional regulator"
FT                   /note="Similar to Bacillus subtilis probable repressor
FT                   protein ydcN TR:P96631 (EMBL:AB001488) (127 aa) fasta
FT                   scores: E(): 0.00029, 34.61% id in 130 aa, and to Bacillus
FT                   subtilis sinr protein sinr or sin or flaD SW:SINR_BACSU
FT                   (P06533) (111 aa) fasta scores: E(): 0.0059, 42.02% id in
FT                   69 aa"
FT                   /db_xref="GOA:Q8KNW6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027910"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNW6"
FT                   /protein_id="CAD30074.1"
FT                   /translation="MKNRIKEIRKKNGDTLKDLAKKTNYDYSNLSKIERGIYTPSLNIL
FT                   KKISTIYNIDIQYLIELDEKCEDELNEKEFILDINLNSQELLKKYNLILDGKLATEDEI
FT                   ELVVQIIRKLRETLEKKKNG"
FT   misc_feature    14981..15148
FT                   /note="HMMSmart hit to SM00530, Helix-turn-helix XRE-family
FT                   like proteins, DNA-binding"
FT   misc_feature    14984..15148
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix"
FT   CDS             15455..15574
FT                   /transl_table=11
FT                   /gene="pBt015"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNW5"
FT                   /protein_id="CAD30075.1"
FT                   /translation="MKKIIILYGLVYILYQKLKGKPPALVGMVRKITINFSYA"
FT   CDS             complement(15601..16032)
FT                   /transl_table=11
FT                   /gene="pBt016"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNW4"
FT                   /protein_id="CAD30076.1"
FT                   /translation="MKENINLNSVVFNTLKQYEQAFTIMTFRFTKIDEDFYYTYIDPAL
FT                   VDNMQLSKKHFINRRLQDICINREIFNKMYTYYELAWKNEQSNLYIFNLNTHIYIIYFK
FT                   KIYVEKEKEVVQGHCIPINPNSELLSALDIPIVHRFDFI"
FT   regulatory      complement(16039..16043)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(16173..16355)
FT                   /transl_table=11
FT                   /gene="pBt017"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNW3"
FT                   /protein_id="CAD30077.1"
FT                   /translation="MENTNNILKEISINFQLSATFIKLRYSKFYSNNIFILITFSFSNC
FT                   SNTIKYLRDKVILSL"
FT   CDS             17229..17369
FT                   /transl_table=11
FT                   /gene="pBt020"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNW2"
FT                   /protein_id="CAD30078.1"
FT                   /translation="MWMCEEQILEKGECRLTHDFGYNLRMVGNTTSIYTCDITIFNKYS
FT                   Y"
FT   CDS             complement(17372..18121)
FT                   /transl_table=11
FT                   /gene="cyt1AA"
FT                   /gene_synonym="cytA"
FT                   /gene_synonym="pBt021"
FT                   /product="type-1AA cytolytic delta-endotoxin"
FT                   /note="Previously sequenced as Bacillus thuringiensis
FT                   (subsp. israelensis) type-1aa cytolytic delta-endotoxin
FT                   cyt1AA or cytA SW:CXAA_BACTI (P05069) (249 aa) fasta
FT                   scores: E(): 2.5e-94, 100% id in 249 aa"
FT                   /db_xref="GOA:Q7AL78"
FT                   /db_xref="InterPro:IPR001615"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AL78"
FT                   /protein_id="CAD30079.1"
FT                   /translation="MENLNHCPLEDIKVNPWKTPQSTARVITLRVEDPNEINNLLSINE
FT                   IDNPNYILQAIMLANAFQNALVPTSTDFGDALRFSMPKGLEIANTITPMGAVVSYVDQN
FT                   VTQTNNQVSVMINKVLEVLKTVLGVALSGSVIDQLTAAVTNTFTNLNTQKNEAWIFWGK
FT                   ETANQTNYTYNVLFAIQNAQTGGVMYCVPVGFEIKVSAVKEQVLFFTIQDSASYNVNIQ
FT                   SLKFAQPLVSSSQYPIADLTSAINGTL"
FT   misc_feature    complement(17375..18049)
FT                   /note="BlastProDom hit to PD009844, PD009844"
FT   misc_feature    complement(17375..18070)
FT                   /note="HMMPfam hit to PF01338, Bacillus thuringiensis
FT                   toxin"
FT   regulatory      complement(18132..18137)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      19135..19138
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             19150..19689
FT                   /transl_table=11
FT                   /gene="p19"
FT                   /gene_synonym="pBt022"
FT                   /product="19kda accessory protein"
FT                   /note="Previously sequenced as Bacillus thuringiensis 19kda
FT                   accessory protein p19 TR:Q9R832 (EMBL:AJ010753) (179 aa)
FT                   fasta scores: E(): 2.2e-74, 100% id in 179 aa, and similar
FT                   to Paenibacillus popilliae Crybp1 protein crybp1 TR:Q45357
FT                   (EMBL:X99049) (175 aa) fasta scores: E(): 1.3e-28, 42.94%
FT                   id in 170 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AL77"
FT                   /protein_id="CAD30080.1"
FT                   /translation="MNMNFDFEDHENKNLSVQEEHHHCSEGGEHKIAFCCVVSIPKGFK
FT                   YVAHCDPKFVYNLDCLSVSKEKCRKVVPIEGCGCAEVDLHVLKVKGCISFVSNIEIEPI
FT                   HECMTCSANPHKENIAVSCQDTVCVDQVLYCSVDCLPDCDINCDNVKICDVSIEPIGDC
FT                   DCHAVKIKGKFSLHYK"
FT   regulatory      19772..19775
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             19788..21719
FT                   /transl_table=11
FT                   /gene="cry11AA"
FT                   /gene_synonym="cryXIA(A)D"
FT                   /gene_synonym="cryIVD"
FT                   /gene_synonym="cryD"
FT                   /gene_synonym="pBt023"
FT                   /product="pesticidial crystal protein cry11AA"
FT                   /note="Previously sequenced as Bacillus thuringiensis
FT                   pesticidial crystal protein cry11aa cry11aa or cryxia(a) or
FT                   cryivd or cryD SW:CBAA_BACTI (P21256) (643 aa) fasta
FT                   scores: E(): 0, 100% id in 643 aa, and Bacillus
FT                   thuringiensis 67 kD mosquitocidal protein TR:AAA22611
FT                   (EMBL:M22860) (78 aa) fasta scores: E(): 8.6e-25, 100% id
FT                   in 78 aa"
FT                   /db_xref="GOA:Q7AL76"
FT                   /db_xref="InterPro:IPR005639"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AL76"
FT                   /protein_id="CAD30081.1"
FT                   /translation="MEDSSLDTLSIVNETDFPLYNNYTEPTIAPALIAVAPIAQYLATA
FT                   IGKWAAKAAFSKVLSLIFPGSQPATMEKVRTEVETLINQKLSQDRVNILNAEYRGIIEV
FT                   SDVFDAYIKQPGFTPATAKGYFLNLSGAIIQRLPQFEVQTYEGVSIALFTQMCTLHLTL
FT                   LKDGILAGSAWGFTQADVDSFIKLFNQKVLDYRTRLMRMYTEEFGRLCKVSLKDGLTFR
FT                   NMCNLYVFPFAEAWSLMRYEGLKLQSSLSLWDYVGVSIPVNYNEWGGLVYKLLMGEVNQ
FT                   RLTTVKFNYSFTNEPADIPARENIRGVHPIYDPSSGLTGWIGNGRTNNFNFADNNGNEI
FT                   MEVRTQTFYQNPNNEPIAPRDIINQILTAPAPADLFFKNADINVKFTQWFQSTLYGWNI
FT                   KLGTQTVLSSRTGTIPPNYLAYDGYYIRAISACPRGVSLAYNHDLTTLTYNRIEYDSPT
FT                   TENIIVGFAPDNTKDFYSKKSHYLSETNDSYVIPALQFAEVSDRSFLEDTPDQATDGSI
FT                   KFARTFISNEAKYSIRLNTGFNTATRYKLIIRVRVPYRLPAGIRVQSQNSGNNRMLGSF
FT                   TANANPEWVDFVTDAFTFNDLGITTSSTNALFSISSDSLNSGEEWYLSQLFLVKESAFT
FT                   TQINPLLK"
FT   misc_feature    19950..20339
FT                   /note="HMMPfam hit to PF00555, delta endotoxin"
FT   misc_feature    20196..20243
FT                   /note="ScanRegExp hit to PS00225, Crystallins beta and
FT                   gamma 'Greek key' motif signature."
FT   regulatory      21988..21992
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             22000..22548
FT                   /transl_table=11
FT                   /gene="p21"
FT                   /gene_synonym="pBt024"
FT                   /product="20 kDa accessory protein (molecular chaperone)"
FT                   /note="Similar to Bacillus thuringiensis 20 kDa accessory
FT                   protein TR:Q45775 (EMBL:M22860) (182 aa) fasta scores: E():
FT                   3.1e-67, 100% id in 182 aa, and to Bacillus thuringiensis
FT                   molecular chaperone protein p21 TR:Q9S6N8 (EMBL:AJ133902)
FT                   (182 aa) fasta scores: E(): 1e-66, 98.9% id in 182 aa"
FT                   /db_xref="GOA:Q7AL75"
FT                   /db_xref="InterPro:IPR001615"
FT                   /db_xref="InterPro:IPR008423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AL75"
FT                   /protein_id="CAD30082.1"
FT                   /translation="MTENGVFYKIFTTENNNFCINPTLLERVFKNNLDEFDFSLVKKNL
FT                   EHEKNCVITSTMNQTISFENMNSTEMGHKTYSFLNQTVLNNKGNSSLEEQVSNIFYRCV
FT                   YMEVGKSSSYIKPLEQDSNKIRYVCSLLFIVPYKNNITSIIPVNLQLTLLSKNVKQSSS
FT                   TNIFSGDIHFNMVTMTYLT"
FT   CDS             22932..23030
FT                   /transl_table=11
FT                   /gene="pBt025"
FT                   /product="pesticidial crystal protein (fragment)"
FT                   /note="Similar to Bacillus thuringiensis pesticidial
FT                   crystal protein cry28AA or cryXXVIIIA(A) SW:CSAA_BACTF
FT                   (Q9X682) (1109 aa) fasta scores: E(): 0.00031, 70.96% id in
FT                   31 aa. May form a deletion remnant with the downstream gene
FT                   pBt026"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNW1"
FT                   /protein_id="CAD30083.1"
FT                   /translation="MLKHDHGYVLRVTAKKEGLSNGTVTISGDANQ"
FT   CDS             23052..23156
FT                   /transl_table=11
FT                   /gene="pBt026"
FT                   /product="pesticidial crystal protein (fragment)"
FT                   /note="Similar to Bacillus thuringiensis pesticidial
FT                   crystal protein cry28AA or cryXXVIIIA(A) SW:CSAA_BACTF
FT                   (Q9X682) (1109 aa) fasta scores: E(): 0.0013, 61.53% id in
FT                   26 aa. May form a deletion remnant with the upstream gene
FT                   pBt025"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNW0"
FT                   /protein_id="CAD30084.1"
FT                   /translation="MIIIQVVYEQIEYTTKTIELFPDTDQVRVDISET"
FT   repeat_region   23072..23208
FT                   /note="CRY repeat"
FT   repeat_region   23321..23325
FT                   /rpt_type=DIRECT
FT   repeat_region   complement(23326..23354)
FT                   /rpt_type=INVERTED
FT   repeat_region   complement(23326..25314)
FT                   /note="IS231W"
FT   CDS             complement(23493..24164)
FT                   /transl_table=11
FT                   /gene="pBt027"
FT                   /product="IS231W transposase"
FT                   /note="Similar to Bacillus thuringiensis IS231W ORF 2
FT                   TR:Q45713 (EMBL:M83546) (250 aa) fasta scores: E():
FT                   1.7e-87, 100% id in 223 aa, and to Bacillus thuringiensis
FT                   transposase for insertion sequence element is231e
FT                   SW:T23E_BACTF (Q02403) (478 aa) fasta scores: E(): 1.7e-51,
FT                   58.52% id in 217 aa"
FT                   /db_xref="GOA:Q8KHX5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KHX5"
FT                   /protein_id="CAD30085.1"
FT                   /translation="MIDLETIMEQLQPGELYEIPVVYVGRDYLLPVRAVMYRLTPDQET
FT                   QRRKDRAYKEKKKNITFSDRTKKLQGINVYITNIPLEYVSKEAIHEFYSLRWQIEIIFK
FT                   TWKSIFRIHSNTNVKKERLECHIYGKLIALLLSSTVMFQMRQVLLIKKQKELSEWKAMY
FT                   MIHDYFRVLYRQIQEQSKQLITSFLRLFHLLDKNGRKSHRYRKKTVFDILGTAYEQYIE
FT                   K"
FT   misc_feature    complement(23757..24149)
FT                   /note="HMMPfam hit to PF01609, Transposase (IS4 family)"
FT   CDS             complement(24161..24913)
FT                   /transl_table=11
FT                   /gene="pBt028"
FT                   /product="IS231W transposase"
FT                   /note="Similar to Bacillus thuringiensis transposase IS231W
FT                   ORF 1 TR:Q45714 (EMBL:M83546) (250 aa) fasta scores: E():
FT                   2.8e-95, 100% id in 250 aa, and to Bacillus thuringiensis
FT                   transposase for insertion sequence element IS231E
FT                   SW:T23E_BACTF (Q02403) (478 aa) fasta scores: E(): 3.8e-42,
FT                   50.21% id in 237 aa"
FT                   /db_xref="GOA:Q7AL74"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AL74"
FT                   /protein_id="CAD30086.1"
FT                   /translation="MKKSSHFKDFRLLVKELQRVFSSHFLTHLGKETQFVQRTSKFGAQ
FT                   DLAALCIGMGQDIASYSLTRLCGVLESETGVLISPEGLNVRLNEKAVEFLRSLFSQLLQ
FT                   KQLLATISLPSSFSEYFRRIRILDATTFQISDQLAAVYPGSGGSGKASGVKIQLEYDLL
FT                   SGQFLHVALGPAKENDVNYGKEVQPTVDLQDLCIRDLGYFSLIDLDGIQQKGAYYLSRL
FT                   KMNTKLFQKMKRPLFLKMEQVKKNINIQ"
FT   misc_feature    complement(24167..24550)
FT                   /note="HMMPfam hit to PF01609, Transposase (IS4 family)"
FT   regulatory      complement(24921..24925)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      24966..24970
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             24979..25239
FT                   /transl_table=11
FT                   /gene="pBt029"
FT                   /product="putative DNA binding protein"
FT                   /note="Similar to fragment of Helicobacter pylori
FT                   preprotein translocase secA subunit hp0786 SW:SECA_HELPY
FT                   (O25475) blast scores: E(): 0.29, score: 34 48% id.
FT                   Contains HMMPfam hit to PF02810, SEC-C motif (The motif is
FT                   predicted to chelate zinc with the CXC and C[HC] pairs that
FT                   constitute the most conserved feature of the motif. It is
FT                   predicted to be a potential nucleic acid binding domain.)"
FT                   /db_xref="GOA:Q8KNV9"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNV9"
FT                   /protein_id="CAD30087.1"
FT                   /translation="MCLLGSEKNPIMIKVGTRARAEKIAAICDDYDLYYIISLELNEDL
FT                   TDLKKAMKGRTRPMDIYDTCACNSGKKYKFCCMSKEIELDI"
FT   misc_feature    25159..25221
FT                   /note="HMMPfam hit to PF02810, SEC-C motif"
FT   repeat_region   25286..25314
FT                   /rpt_type=INVERTED
FT   repeat_region   25315..25319
FT                   /rpt_type=DIRECT
FT   regulatory      25838..25842
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             25852..26157
FT                   /transl_table=11
FT                   /gene="pBt030"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNV8"
FT                   /protein_id="CAD30088.1"
FT                   /translation="MGMPTIPEGLDITRDQAINIILASIGLEELGLAHVINAEGEKVQA
FT                   VVAGFEKETVTFDQLLATNESVTQTLKTVIKKEMLLQFKLEEAKSLIQSSSPPSIS"
FT   CDS             complement(26389..27204)
FT                   /transl_table=11
FT                   /gene="pBt031"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase
FT                   (peptidoglycan hydrolase)"
FT                   /note="Similar to Bacillus phage GA-1 peptidoglycan
FT                   hydrolase gene 15 TR:Q9FZW0 (EMBL:X96987) (239 aa) fasta
FT                   scores: E(): 2.5e-24, 42.07% id in 202 aa, and to Bacillus
FT                   licheniformis N-acetylmuramoyl-L-alanine amidase CwlM cwlM
FT                   SW:CWLM_BACLI (P37134) (253 aa) fasta scores: E(): 2.3e-21,
FT                   33.2% id in 256 aa"
FT                   /db_xref="GOA:Q8KIW1"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KIW1"
FT                   /protein_id="CAD30089.1"
FT                   /translation="MVKVWLDAGHGAHDSGAVGHSLLEKNIVLELALSTYEYLNEHYDD
FT                   IIVGMTRFNDTFKTLQERCNMANRFGADIFVSFHCNSGATNGVPGNGFETFRFPGTTGD
FT                   TLRLQQVTHHSIFSFYAKHGLRNRGMKEASFAVLRGTNMPAVLTENLFMNHTEILKFNN
FT                   ATFLYHVAEAHAHGIAEYFGLKPKVDKNKLVPIYQIHLGDFNSIEWTADTLRKVKEIFP
FT                   GYGVWTKCLEGNAHRIILGDFSGESWADDTLSQLQGNFPDYGAWKKRLN"
FT   misc_feature    complement(26656..27015)
FT                   /note="HMMPfam hit to PF01520, N-acetylmuramoyl-L-alanine
FT                   amidase"
FT   regulatory      complement(27213..27217)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      27658..27661
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             27672..27983
FT                   /transl_table=11
FT                   /gene="pBt032"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNV7"
FT                   /protein_id="CAD30090.1"
FT                   /translation="MGIPNIPEGLDITREQAINIILASIGLEELGLAHVINAEGEKVQA
FT                   VVTEFKKGKVSLDQLLATNESTVDTLKTVIKKEMLLQLKLEETKSILKLCSCRKSSDY"
FT   CDS             28123..28266
FT                   /transl_table=11
FT                   /gene="pBt033"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNV6"
FT                   /protein_id="CAD30091.1"
FT                   /translation="MWSMIFFCSFLWKVRREVRNLMDVANGYQNNIFLEKCLFKIFNYS
FT                   PH"
FT   CDS             28842..29150
FT                   /transl_table=11
FT                   /gene="pBt034"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C-terminal half of Bacillus anthracis
FT                   pxo1-106 TR:Q9X375 (EMBL:AF065404) (126 aa) fasta scores:
FT                   E(): 2.5e-11, 62.68% id in 67 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNV5"
FT                   /protein_id="CAD30092.1"
FT                   /translation="MYNNRKTSYEMGRGKPMFNQQLVNLRIDFAFKQLFGTSGNEDILV
FT                   AFLNAMLQNSLESSIVSLQLEDPYLHREHEEDKLSIINFRYFSGIRYRNKGKCRNTA"
FT   CDS             29164..29769
FT                   /transl_table=11
FT                   /gene="pBt035"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar in part to Bacillus anthracis pxo1-71
FT                   TR:Q9X341 (EMBL:AF065404) (85 aa) fasta scores: E():
FT                   3.6e-09, 36.98% id in 73 aa, and to Rickettsia conorii
FT                   hypothetical 12.1 kDa protein rc1156 TR:AAL03694
FT                   (EMBL:AE008664) (102 aa) fasta scores: E(): 2.2e-05, 37.5%
FT                   id in 80 aa, and to Bacillus anthracis pxo1-72 TR:Q9X342
FT                   (EMBL:AF065404) (101 aa) fasta scores: E(): 0.0032, 32.32%
FT                   id in 99 aa"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNV4"
FT                   /protein_id="CAD30093.1"
FT                   /translation="MIKRSLYYWGRLYTSQLQKGMPYSFLHQTITINLLNFEMFPKHEA
FT                   FHTTGILWNQQQQQVLSDDIEIHIVEIPKLMQQWRNEQINPWEDSFVRWLLLLTANEDE
FT                   KLTQTLEDIAMNQDPILQKAMNKWERMSQDSSFRQAYAAREKVLMDEAAKFAYAEQTGI
FT                   EKGKMQLIRGMHKNGMAIEDIAKFSGLTEMEMRRFLQN"
FT   CDS             complement(30321..31112)
FT                   /transl_table=11
FT                   /gene="cyt2BA1"
FT                   /gene_synonym="cyt2BA7"
FT                   /gene_synonym="cytB"
FT                   /gene_synonym="pBt036"
FT                   /product="type-2BAa cytolytic delta-endotoxin"
FT                   /note="Previously sequenced as Bacillus thuringiensis
FT                   type-2BA cytolytic delta-endotoxin cyt2BA1 or cyt2BA7 or
FT                   cytB SW:CYBA_BACTI (Q45723) (263 aa) fasta scores: E():
FT                   3.7e-101, 100% id in 263 aa"
FT                   /db_xref="GOA:Q7AL73"
FT                   /db_xref="InterPro:IPR001615"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AL73"
FT                   /protein_id="CAD30094.1"
FT                   /translation="MHLNNLNNFNNLENNGEYHCSGPIIKKPFRHIALTVPSSDITNFN
FT                   EIFYVEPQYIAQAIRLTNTFQGAIDPLTLNFNFEKALQIANGLPNAGVTGTINQSVIHQ
FT                   TIEVSVMISQIKEIIRSVLGLVINSANFWNSVVSAITNTFTNLEPQVDENWIVWRNLSA
FT                   TQTSYFYKILFSIQNEDTGRFMAILPIAFEITVDVQKQQLLFITIKDSARYEVKMKALT
FT                   VVQALDSYNAPIIDVFNVRNYSLHRPNHNILQNLNVNPIKS"
FT   misc_feature    complement(30327..31064)
FT                   /note="BlastProDom hit to PD009844, PD009844"
FT   misc_feature    complement(30378..31052)
FT                   /note="HMMPfam hit to PF01338, Bacillus thuringiensis
FT                   toxin"
FT   regulatory      complement(31124..31130)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      32585..32589
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             32597..36007
FT                   /transl_table=11
FT                   /gene="cry4BA"
FT                   /gene_synonym="cryIVB(A)"
FT                   /gene_synonym="BT8"
FT                   /gene_synonym="isrH3"
FT                   /gene_synonym="cryD2"
FT                   /gene_synonym="pBt038"
FT                   /product="pesticidial crystal protein cry4BA"
FT                   /note="Previously sequenced as Bacillus thuringiensis
FT                   pesticidial crystal protein cry4BA or cryIVB(A) or BT8 or
FT                   isrH3 or cryD2 SW:C4BA_BACTI (P05519) (1136 aa) fasta
FT                   scores: E(): 0, 100% id in 1136 aa"
FT                   /db_xref="GOA:Q7AL72"
FT                   /db_xref="InterPro:IPR001178"
FT                   /db_xref="InterPro:IPR005638"
FT                   /db_xref="InterPro:IPR005639"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AL72"
FT                   /protein_id="CAD30095.1"
FT                   /translation="MNSGYPLANDLQGSMKNTNYKDWLAMCENNQQYGVNPAAINSSSV
FT                   STALKVAGAILKFVNPPAGTVLTVLSAVLPILWPTNTPTPERVWNDFMTNTGNLIDQTV
FT                   TAYVRTDANAKMTVVKDYLDQYTTKFNTWKREPNNQSYRTAVITQFNLTSAKLRETAVY
FT                   FSNLVGYELLLLPIYAQVANFNLLLIRDGLINAQEWSLARSAGDQLYNTMVQYTKEYIA
FT                   HSITWYNKGLDVLRNKSNGQWITFNDYKREMTIQVLDILALFASYDPRRYPADKIDNTK
FT                   LSKTEFTREIYTALVESPSSKSIAALEAALTRDVHLFTWLKRVDFWTNTIYQDLRFLSA
FT                   NKIGFSYTNSSAMQESGIYGSSGFGSNLTHQIQLNSNVYKTSITDTSSPSNRVTKMDFY
FT                   KIDGTLASYNSNITPTPEGLRTTFFGFSTNENTPNQPTVNDYTHILSYIKTDVIDYNSN
FT                   RVSFAWTHKIVDPNNQIYTDAITQVPAVKSNFLNATAKVIKGPGHTGGDLVALTSNGTL
FT                   SGRMEIQCKTSIFNDPTRSYGLRIRYAANSPIVLNVSYVLQGVSRGTTISTESTFSRPN
FT                   NIIPTDLKYEEFRYKDPFDAIVPMRLSSNQLITIAIQPLNMTSNNQVIIDRIEIIPITQ
FT                   SVLDETENQNLESEREVVNALFTNDAKDALNIGTTDYDIDQAANLVECISEELYPKEKM
FT                   LLLDEVKNAKQLSQSRNVLQNGDFESATLGWTTSDNITIQEDDPIFKGHYLHMSGARDI
FT                   DGTIFPTYIFQKIDESKLKPYTRYLVRGFVGSSKDVELVVSRYGEEIDAIMNVPADLNY
FT                   LYPSTFDCEGSNRCETSAVPANIGNTSDMLYSCQYDTGKKHVVCQDSHQFSFTIDTGAL
FT                   DTNENIGVWVMFKISSPDGYASLDNLEVIEEGPIDGEALSRVKHMEKKWNDQMEAKRSE
FT                   TQQAYDVAKQAIDALFTNVQDEALQFDTTLAQIQYAEYLVQSIPYVYNDWLSDVPGMNY
FT                   DIYVELDARVAQARYLYDTRNIIKNGDFTQGVMGWHVTGNADVQQIDGVSVLVLSNWSA
FT                   GVSQNVHLQHNHGYVLRVIAKKEGPGNGYVTLMDCEENQEKLTFTSCEEGYITKTVDVF
FT                   PDTDRVRIEIGETEGSFYIESIELICMNE"
FT   misc_feature    32609..34498
FT                   /note="HMMPfam hit to PF00555, delta endotoxin"
FT   repeat_region   34393..36353
FT                   /note="CP repeat"
FT   CDS             complement(join(37627..38007,38009..38311))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pBt043"
FT                   /product="probable IS element transposase (pseudogene)"
FT                   /note="Similar to Lactococcus lactis orf-w2 protein
FT                   TR:Q48685 (EMBL:M37396) (226 aa) fasta scores: E():
FT                   6.5e-50, 56.88% id in 225 aa, and to Enterococcus faecium
FT                   transposase TR:Q47818 (EMBL:U49512) (226 aa) fasta scores:
FT                   E(): 8.8e-50, 56.75% id in 222 aa. Contains frameshift."
FT   misc_feature    complement(37645..37980)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(38030..38119)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   regulatory      complement(38320..38324)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             38548..38655
FT                   /transl_table=11
FT                   /gene="pBt045"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNV3"
FT                   /protein_id="CAD30097.1"
FT                   /translation="MDTFVQTGGVYEPLWSGVRTWMDEKGWYYEVRQTM"
FT   regulatory      39049..39053
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             39061..41088
FT                   /transl_table=11
FT                   /gene="cry10AA"
FT                   /gene_synonym="cryXA(A)"
FT                   /gene_synonym="cryIVC"
FT                   /gene_synonym="pBt047"
FT                   /product="pesticidial crystal protein cry10AA"
FT                   /note="Previously sequenced as Bacillus thuringiensis
FT                   pesticidial crystal protein cry10AA or cryXA(A) or cryIVC
FT                   SW:CAAA_BACTI (P09662) (675 aa) fasta scores: E(): 0,
FT                   99.85% id in 675 aa"
FT                   /db_xref="GOA:Q8KNV2"
FT                   /db_xref="InterPro:IPR001178"
FT                   /db_xref="InterPro:IPR005638"
FT                   /db_xref="InterPro:IPR005639"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNV2"
FT                   /protein_id="CAD30098.1"
FT                   /translation="MNPYQNKNEYEIFNAPSNGFSKSNNYSRYPLANKPNQPLKNTNYK
FT                   DWLNVCQDNQQYGNNAGNFASSETIVGVSAGIIVVGTMLGAFAAPVLAAGIISFGTLLP
FT                   IFWQGSDPANVWQDLLNIGGRPIQEIDKNIINVLTSIVTPIKNQLDKYQEFFDKWEPAR
FT                   THANAKAVHDLFTTLEPIIDKDLDMLKNNASYRIPTLPAYAQIATWHLNLLKHAATYYN
FT                   IWLQNQGINPSTFNSSNYYQGYLKRKIQEYTDYCIQTYNAGLTMIRTNTNATWNMYNTY
FT                   RLEMTLTVLDLIAIFPNYDPEKYPIGVKSELIREVYTNVNSDTFRTITELENGLTRNPT
FT                   LFTWINQGRFYTRNSRDILDPYDIFSFTGNQMAFTHTNDDRNIIWGAVHGNIISQDTSK
FT                   VFPFYRNKPIDKVEIVRHREYSDIIYEMIFFSNSSEVFRYSSNSTIENNYKRTDSYMIP
FT                   KQTWKNKEYGHTLSYIKTDNYIFSVVRERRRVAFSWTHTSVDFQNTIDLDNITQIHALK
FT                   ALKVSSDSKIVKGPGHTGGDLVILKDSMDFRVRFLKNVSRQYQVRIRYATNAPKTTVFL
FT                   TGIDTISVELPSTTSRQNPNATDLTYADFGYVTFPRTVPNKTFEGEDTLLMTLYGTPNH
FT                   SYNIYIDKIEFIPITQSVLDYTEKQNIEKTQKIVNDLFVN"
FT   misc_feature    39145..41010
FT                   /note="HMMPfam hit to PF00555, delta endotoxin"
FT   misc_feature    39268..39336
FT                   /note="1 probable transmembrane helix predicted for pBt047
FT                   by TMHMM2.0"
FT   regulatory      41141..41144
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             41155..42624
FT                   /transl_table=11
FT                   /gene="pBt048"
FT                   /product="putative pesticidial crystal protein"
FT                   /note="Similar to C-terminus of Bacillus thuringiensis
FT                   pesticidial crystal protein cry4ba or cryivb(a) or bt8 or
FT                   isrh3 or cryd2 SW:C4BA_BACTI (P05519) (1136 aa) fasta
FT                   scores: E(): 6.3e-150, 80.52% id in 493 aa, and to
FT                   C-terminus of Bacillus thuringiensis pesticidial crystal
FT                   protein cry4aa cry4aa or cryiva(a) or isrh4 SW:C4AA_BACTI
FT                   (P16480) (1180 aa) fasta scores: E(): 4.7e-149, 79.91% id
FT                   in 493 aa. Similar to full length Bacillus thuringiensis
FT                   jegathesan hypothetical 60.1 kDa protein (downstream of
FT                   cry19Aa) TR:O32308 (EMBL:Y07603) (526 aa) fasta scores:
FT                   E(): 6.6e-147, 75.81% id in 488 aa"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNV1"
FT                   /protein_id="CAD30099.1"
FT                   /translation="MFTSGAKNRLKLETTDYEIDQVANAIECMSDEQYSKEKLMLWDQV
FT                   KHAKYLSQSRNLLQNGDFEDVFHGWTTSDHMYIQSDNSTFKGNYLNISGARDIYLTIFP
FT                   TYIYQKIDESKLKPYTRYLVRGFVGSSKDVELVVSRYGKEIDTVMNVPFDIPYVSSRPV
FT                   CNELYDGEQQPYPNGNVGYYNPMSAFTPSYTSDARQCMPGKKQIVCQDSHQFKFHIDTG
FT                   EVDYNTNIGIWVMFKISSPDGYALLDNLEVIEEGPIDGEALSRVKHMEKKWNDQMEAKR
FT                   SETQQAYDVAKQAIDALFTNVQDEALQFDTTLAQIQYAEYLVQSIPYVYNDWLSDVPGM
FT                   NYDIYVELDARVAQARYLYDTRNIIKNGDFTQGVMGWHVTGNADVQQIDGVSVLVLSNW
FT                   SAGVSQNVHLQHNHGYVLRVIAKKEGPGNGYVTLMDCEENQEKLTFTSCEEGYITKTVD
FT                   VFPDTDCVRIEIGETEGSFYIESIELICMNE"
FT   repeat_region   41726..42643
FT                   /note="CP repeat"
FT   CDS             42770..42865
FT                   /transl_table=11
FT                   /gene="pBt049"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNV0"
FT                   /protein_id="CAD30100.1"
FT                   /translation="MVIVIYNENCGEMYKFESNHGGLDSQSYEYY"
FT   CDS             join(43078..43209,43213..43922)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pBt051"
FT                   /gene_synonym="pBt050"
FT                   /product="transposase for IS231-like element (partial
FT                   pseudogene)"
FT                   /note="Similar to Bacillus anthracis pxo1-36 TR:Q9X307
FT                   (EMBL:AF065404) (484 aa) fasta scores: E(): 1e-103, 90.74%
FT                   id in 281 aa, and to Bacillus thuringiensis transposase for
FT                   insertion sequence element is231d SW:T23D_BACTF (Q05501)
FT                   (478 aa) fasta scores: E(): 1.8e-48, 44.32% id in 273 aa.
FT                   Contains stop codon, and is truncated by IS240 insertion."
FT   misc_feature    43462..43922
FT                   /note="HMMPfam hit to PF01609, Transposase (IS4 family)"
FT   repeat_region   complement(43923..43939)
FT                   /rpt_type=INVERTED
FT   repeat_region   43923..44782
FT                   /note="IS240"
FT   CDS             44014..44721
FT                   /transl_table=11
FT                   /gene="pBt052"
FT                   /product="insertion element IS240 protein"
FT                   /note="Similar to Bacillus thuringiensis insertion element
FT                   is240-a protein TR:Q45766 (EMBL:M23740) (235 aa) fasta
FT                   scores: E(): 3.5e-91, 99.14% id in 235 aa, and to
FT                   Mycobacterium fortuitum, transposase tnp or tnpa or tnp6100
FT                   TR:Q49185 (EMBL:X53635) (254 aa) fasta scores: E():
FT                   1.1e-37, 48.05% id in 231 aa"
FT                   /db_xref="GOA:Q8KH55"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KH55"
FT                   /protein_id="CAD30102.1"
FT                   /translation="MEKENIFKWKHYQADMILWTVRWYLRYNLSFRDLVEMMEERGLSL
FT                   SHTTIMRWVHQYGPELNERIRKHLKRTNDSWRVDETYIKIKGENMYLYRAVDSEGNTLD
FT                   FYLSKKRDAKAAKCFLKKALASFHVTKPRVITVDGNKAYPVAIRELKNEKSIPYGMPLR
FT                   VKKYLNNMIEQDHRFIKKRIRNMLGLKSMQTAVKMIAGIEAMHMVKKGQLKLRAQSAQN
FT                   QNRCIHQLFGLTA"
FT   misc_feature    44215..44610
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   44766..44782
FT                   /rpt_type=INVERTED
FT   repeat_region   44784..44920
FT                   /note="CRY repeat"
FT   CDS             44785..44913
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pBt053"
FT                   /product="probable deletion remnant of pesticidial crystal
FT                   protein"
FT                   /note="Similar to the extreme C-terminus of Bacillus
FT                   thuringiensis pesticidial crystal protein cry26aa cry26aa
FT                   or cryxxvia(a) or cry26aa1 SW:CQAA_BACTF (Q9X597) (1163 aa)
FT                   fasta scores: E(): 5.4e-08, 65.85% id in 41 aa"
FT   CDS             complement(45797..47374)
FT                   /transl_table=11
FT                   /gene="pBt054"
FT                   /product="Possible two-domain toxin"
FT                   /note="Possible two-domain toxin. N-terminal half is
FT                   similar to Bacillus thuringiensis type-1ab cytolytic
FT                   delta-endotoxin cyt1ab1 SW:CXAB_BACTV (P94594) (250 aa)
FT                   fasta scores: E(): 3.9e-42, 52.21% id in 226 aa. The
FT                   C-treminal half is similar to several Ricin-B lectin
FT                   domain-containing toxins e.g. Pieris brassicae pierisin-b
FT                   TR:Q9GV36 (EMBL:AB037676) (850 aa) fasta scores: E():
FT                   1.9e-12, 27.45% id in 306 aa, Bacillus sphaericus
FT                   mosquitocidal toxin protein TR:Q03988 (EMBL:M60446) (870
FT                   aa) fasta scores: E(): 2.8e-08, 25.7% id in 284 aa, and
FT                   Clostridium botulinum main hemagglutinin component ha-33 or
FT                   antp-33 SW:HA33_CLOBO (P46084) (285 aa) fasta scores: E():
FT                   4.1e-06, 27.61% id in 268 aa"
FT                   /db_xref="GOA:Q8KNU9"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR001615"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNU9"
FT                   /protein_id="CAD30104.1"
FT                   /translation="MAQSEFNQNLREQGQSRARVIILRVNNPGYNTNTLDIADIEDIIH
FT                   LPQAIELANAFQSALVPTTSNFGEDTLRFDVERGLGIATHVYPRAINVNYVTRTLSQTN
FT                   NQVQSMINKVIEELKSLLGINLANSVLQQLTTVITETFTNLYVQQQSAWLFWGRQTSSQ
FT                   TNYTYNIVFAIQNAQTGSFMKAIPIGFEISAYIARERLLFFNIQDYASYSVKIHAIQVM
FT                   QPLIHESFQPLRGIFNIITSVNNRSAIQITEYYDENTHDYPVKLWDYNNIINQKWILVF
FT                   NQTTRAYSIQNLIARYLVLTWDSTPGSNKVFASTNRWNDSQFWILESTADGSIFLTNMK
FT                   DTQFVLEIENSSTTNGTNVIVNRKNNNAQQKFYLNKVNQEFQDGVYKIKTALNNSSVLQ
FT                   MSEDYFGYTSDYFVKLWTNNNNDINQKWIFEFDSTKSAYQIKSQRDPSLVLAWTWSVPT
FT                   VKLPIPNNDDHLWFLQNAGSGTYYFVNMTDTRYVLEVASSSTTNGTILTINKRNGNLNQ
FT                   KFLLDMIN"
FT   misc_feature    complement(45809..45934)
FT                   /note="HMMPfam hit to PF00652, QXW lectin repeat"
FT   misc_feature    complement(45809..46228)
FT                   /note="HMMSmart hit to SM00458, Ricin-type beta-trefoil"
FT   misc_feature    complement(45809..46231)
FT                   /note="ProfileScan hit to PS50231, Lectin domain of ricin B
FT                   chain profile."
FT   misc_feature    complement(46079..46219)
FT                   /note="HMMPfam hit to PF00652, QXW lectin repeat"
FT   misc_feature    complement(46244..46375)
FT                   /note="HMMPfam hit to PF00652, QXW lectin repeat"
FT   misc_feature    complement(46250..46555)
FT                   /note="ProfileScan hit to PS50231, Lectin domain of ricin B
FT                   chain profile."
FT   misc_feature    complement(46250..46675)
FT                   /note="HMMSmart hit to SM00458, Ricin-type beta-trefoil"
FT   misc_feature    complement(46388..46513)
FT                   /note="HMMPfam hit to PF00652, QXW lectin repeat"
FT   misc_feature    complement(46529..46663)
FT                   /note="HMMPfam hit to PF00652, QXW lectin repeat"
FT   misc_feature    complement(46643..47341)
FT                   /note="HMMPfam hit to PF01338, Bacillus thuringiensis
FT                   toxin"
FT   misc_feature    complement(46655..47320)
FT                   /note="BlastProDom hit to PD009844, PD009844"
FT   regulatory      complement(47382..47387)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(47792..48193)
FT                   /transl_table=11
FT                   /gene="pBt055"
FT                   /product="putative deletion pseudogene prduct"
FT                   /note="Possible deletion pseudogene; C-terminus is similar
FT                   to C-terminus of genes upstream of toxin genes e.g.
FT                   Bacillus thuringiensis hypothetical 29.1 kDa protein in
FT                   cryb1 5'region SW:YCR2_BACTK (P21733) (252 aa) fasta
FT                   scores: E(): 9.1e-07, 36.66% id in 90 aa; N-terminus is
FT                   similar to N-terminus of e.g. Bacillus thuringiensis
FT                   pesticidial crystal protein cry11bb cry11bb or cryxib(b)
FT                   SW:CBBB_BACTV (Q9ZIU5) (750 aa) fasta scores: E(): 7e-07,
FT                   40.47% id in 84 aa, and to Bacillus thuringiensis
FT                   hypothetical 29.1 kDa protein in cryb1 5'region
FT                   SW:YCR2_BACTK (P21733) (252 aa) fasta scores: E(): 9.1e-07,
FT                   36.66% id in 90 aa"
FT                   /protein_id="CAD30105.1"
FT                   /translation="MNNRSFLNLKRGDCIYVYSGGTLEAQGRYLHVVEDKNELFLCWRK
FT                   HNGNEVYTNLNGISVETINENTAYLQNTRATCERGYNNNYDDNSNSSHEHGYNNNYGHN
FT                   SSSSHEHGYNNNYYTGCTCGRSHNNNQLK"
FT   misc_feature    complement(47804..48055)
FT                   /note="ProfileScan hit to PS50321, Asparagine-rich region."
FT   regulatory      complement(48202..48206)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(join(48340..48696,48700..48828,48828..49166,
FT                   49166..49354))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pBt056"
FT                   /product="hypothetical protein (pseudogene)"
FT                   /note="Potential pseudogene; matches pBt152 with two
FT                   frameshifts and an in-frame stop"
FT   regulatory      complement(49363..49366)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(49416..49673)
FT                   /transl_table=11
FT                   /gene="pBt059"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to N-terminus of genes upstream of Bt toxin
FT                   genes e.g. Bacillus thuringiensis hypothetical 29.1 kDa
FT                   protein in cryb1 5'region SW:YCR2_BACTK (P21733) (252 aa)
FT                   fasta scores: E(): 1.1e-08, 41.17% id in 85 aa, and
FT                   Bacillus thuringiensis orf 2 TR:Q45742 (EMBL:X57252) (400
FT                   aa) fasta scores: E(): 1.6e-08, 47.76% id in 67 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNU8"
FT                   /protein_id="CAD30107.1"
FT                   /translation="MLQHLFLDLRKYEYLQIYSSGKLEGQGMYVGLVEDNNQTFLCWRN
FT                   EKGNKIYTNINFISIEKLSTDDNCGHHNYPNCNCDPNYND"
FT   regulatory      complement(49685..49688)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      50079..50083
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             join(50087..50749,50751..50879,50882..51550)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pBt060"
FT                   /product="spore germination GerIA-like protein
FT                   (pseudogene)"
FT                   /note="Similar to N-terminus of Bacillus cereus spore
FT                   germination protein GerIA SW:GRIA_BACCE (O85467) (663 aa)
FT                   fasta scores: E(): 8.4e-53, 35.54% id in 467 aa. Contains
FT                   two potential frameshifts."
FT   misc_feature    join(51218..51286,51329..51397)
FT                   /note="2 probable transmembrane helices predicted for
FT                   pBt062 by TMHMM2.0"
FT   regulatory      51555..51561
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             51569..51844
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pBt063"
FT                   /product="spore germination GerIB-like protein
FT                   (pseudogene)"
FT                   /note="Similar to N-terminus of Bacillus halodurans spore
FT                   germination protein bh1598 TR:Q9KCH3 (EMBL:AP001512) (370
FT                   aa) fasta scores: E(): 3.8e-05, 33.33% id in 87 aa, and to
FT                   Bacillus cereus spore germination protein GeriB geriB
FT                   TR:O85468 (EMBL:AF067645) (364 aa) fasta scores: E():
FT                   0.00023, 30.52% id in 95 aa. Truncated by IS240 insertion."
FT   misc_feature    join(51611..51679,51692..51760,51788..51844)
FT                   /note="3 probable transmembrane helices predicted for
FT                   pBt063 by TMHMM2.0"
FT   repeat_region   complement(51845..51861)
FT                   /rpt_type=INVERTED
FT   repeat_region   complement(51845..52346)
FT                   /note="IS240 (partial)"
FT   CDS             complement(51910..52344)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pBt064"
FT                   /product="IS240 protein (partial)"
FT                   /note="Similar to Bacillus thuringiensis insertion element
FT                   IS240-a protein TR:Q45766 (EMBL:M23740) (235 aa) fasta
FT                   scores: E(): 1.1e-54, 99.31% id in 146 aa"
FT   misc_feature    complement(52018..52346)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   regulatory      52573..52578
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    52587..52781
FT                   /note="ProfileScan hit to PS50320, Methionine-rich region."
FT   CDS             52587..52799
FT                   /transl_table=11
FT                   /gene="pBt065"
FT                   /product="hypothetical Methionine-rich protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KGI4"
FT                   /protein_id="CAD30111.1"
FT                   /translation="MEKTMMVGTTNMMMSMEKMMCEMKCMKMMMNNMMQMNVNMDKAMV
FT                   NTMHECDEMMTSTMSMMKAMKEKCC"
FT   regulatory      53198..53202
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             53209..53565
FT                   /transl_table=11
FT                   /gene="pBt066"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNU7"
FT                   /protein_id="CAD30112.1"
FT                   /translation="MYMIFLYRFDLKENGIDFVLNEQIAADMLPHYDALLRPLVASLAD
FT                   TLQLYRSLSTHPTILTGKILDNGQLEVMLSEGLGQYIDIYTKNQIIFENGKRIADILVN
FT                   VMDSHTSKTLKRTH"
FT   CDS             complement(53930..54991)
FT                   /transl_table=11
FT                   /gene="pBt067"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to several other gene fragments e.g.
FT                   Bacillus anthracis pxo1-71 TR:Q9X341 (EMBL:AF065404) (85
FT                   aa) fasta scores: E(): 1.9e-09, 42.46% id in 73 aa, and to
FT                   Rickettsia conorii hypothetical 12.1 kDa protein rc1156
FT                   TR:AAL03694 (EMBL:AE008664) (102 aa) fasta scores: E():
FT                   2.9e-06, 37.5% id in 96 aa, and to Bacillus anthracis
FT                   pxo1-72 TR:Q9X342 (EMBL:AF065404) (101 aa) fasta scores:
FT                   E(): 8.6e-05, 32.99% id in 97 aa, and to Rickettsia conorii
FT                   hypothetical 8.9 kDa protein rc1157 TR:AAL03695
FT                   (EMBL:AE008664) (78 aa) fasta scores: E(): 0.00038, 48.43%
FT                   id in 64 aa, and to Bacillus anthracis pxo1-106 TR:Q9X375
FT                   (EMBL:AF065404) (126 aa) fasta scores: E(): 0.00065, 35% id
FT                   in 100 aa"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNU6"
FT                   /protein_id="CAD30113.1"
FT                   /translation="MFIKTKHSKNNNKGCFFSPSSATIDIYFLCPFPRKRGITKKTEYE
FT                   IRKVTHSMNQPLVNLRVDFAFKQLFGVQGQEELLISFLNAILHESLSTPIVSLKIEDPH
FT                   LHKEYEEDKLSILDILATLQDETKVNVEIQLRNTQEIVKRSLYYWSKLYTSQLEQGMPY
FT                   RSLRKTIAINLLDFDLFPQYDDMHTVGQFWSQQHKEVLLEDLEIHFIEIPKLLQQWREE
FT                   KINPWENEFARWLLLLPAHEDEHLTHTLEDIAMKQDPMLQKAIHKWENMSQSSSFRLAY
FT                   EAREKVLFDEQAKLAHAREVGIEEGMEKGKVVGIQEGKIQLIRGMHKNGMDIEDIAKFT
FT                   NMELSEIRNILDK"
FT   CDS             complement(55008..55088)
FT                   /transl_table=11
FT                   /gene="pBt068"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNU5"
FT                   /protein_id="CAD30114.1"
FT                   /translation="MKRWVVNILGRKGDKSVRIGAYTRNI"
FT   regulatory      complement(55097..55102)
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   complement(55511..55523)
FT                   /rpt_type=INVERTED
FT   repeat_region   55511..55797
FT                   /note="IS946-like"
FT   CDS             join(55572..55796,66563..67024)
FT                   /transl_table=11
FT                   /gene="pBt070"
FT                   /product="IS element transposase"
FT                   /note="Similar to Enterococcus faecium transposase
FT                   TR:Q47818 (EMBL:U49512) (226 aa) fasta scores: E():
FT                   1.3e-51, 58.66% id in 225 aa, and to Lactobacillus sakei
FT                   putative is1519r transposase tnp1519R TR:Q9AEC6
FT                   (EMBL:Z54312) (228 aa) fasta scores: E(): 2.1e-51, 58.66%
FT                   id in 225 aa, and to Lactococcus lactis insertion sequence
FT                   is946 transposase TR:Q48653 (EMBL:M33868) (226 aa) fasta
FT                   scores: E(): 5.9e-51, 57.58% id in 224 aa. Interrupted by
FT                   IS231 insertion"
FT                   /db_xref="GOA:Q8KNU4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNU4"
FT                   /protein_id="CAD30115.1"
FT                   /translation="MGYFKGKQFKKDIILVAVGYYCRFSLSYRDVSEILKEQGVSVHPT
FT                   TIMRWVHEYGNLIYQIWKKKNQSAHHVWHVDETYIKVKGEWSYLYRAIDSDGYTLDFQL
FT                   RKTRDHQAAYAFIKRLTKQFGEPTVLTTDQAPALLCAFKKLKNNGFYVHTTHCTVKHLN
FT                   NLIEQDHRHVKRRFAKSSGFQNIRHASRTLKGIKTIHAIYKQKRSQIPDFSFSTYKELQ
FT                   ELFRTA"
FT   misc_feature    join(55764..55796,66563..66874)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(55809..55826)
FT                   /rpt_type=INVERTED
FT   repeat_region   55809..57463
FT                   /note="IS231F"
FT   CDS             complement(55935..57368)
FT                   /transl_table=11
FT                   /gene="pBt071"
FT                   /product="transposase for insertion sequence IS231F"
FT                   /note="Identical to Bacillus thuringiensis transposase for
FT                   insertion sequence element IS231F SW:T23F_BACTI (Q02404)
FT                   (477 aa) fasta scores: E(): 3.6e-192, 100% id in 477 aa"
FT                   /db_xref="GOA:Q7AL69"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AL69"
FT                   /protein_id="CAD30116.1"
FT                   /translation="MNLSIQEELQPFVEELQRYITPEFLEELAREMKFVKRKRKFSGSD
FT                   LATICIWISQRVASDPLVRLCSRLHAVTGTVLSPEGLNKRFNEKSVLFLKHVFSLLLQQ
FT                   KICEQTYISNQLLSHFKRIRIMDATMFQVPHTLEHIYPGSGGCAQTAGIKIQLEYDLHS
FT                   GQFFNFQVGPGKNNDKTFGTECLDTLRPGDLCIRDLGYFSLEDLDQMDQRGTYYISRLK
FT                   LNTNVYVKNPSPEYFKNGAIKKQSEYIQINVIQILNQLQPGETIEYQQAYIGDKQQLFS
FT                   RLVFHRLTAAQLQKRLKKIAEKEKSKHRTYSEKSKLVAGLNVYVTNAPWEWVPMEQVHE
FT                   LYTLRWQIEIVFKTWKSLFDIDHCRTVKQERIECHLYGKLIAIFLCSSTMFKMRQLLLQ
FT                   KKKKELSEYKAIGMIQDHLFLLYQSIQNTQEITKLLTRLFHLLQQNGRKSHRYEKKTVF
FT                   DIMGVIYEYSGCSKQKKAA"
FT   misc_feature    complement(56214..57008)
FT                   /note="HMMPfam hit to PF01609, Transposase (IS4 family)"
FT   repeat_region   57446..57463
FT                   /rpt_type=INVERTED
FT   CDS             complement(57663..58001)
FT                   /transl_table=11
FT                   /gene="pBt072"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to part of Streptomyces hygroscopicus
FT                   varascomyceticus fkbH TR:Q9KIE6 (EMBL:AF235504) (360 aa)
FT                   fasta scores: E(): 2.7e-06, 35.86% id in 92 aa"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNU3"
FT                   /protein_id="CAD30117.1"
FT                   /translation="MQTIQSLHNLGIIQSIASKTDYTKGLAKLKQLGIEKYFVLPQLSS
FT                   NNKSTSIKKIARLFHIKLQKIVFIDNDILELKEVSSKLPQVTCINATKYGGDIYKQVKK
FT                   IINSVEKF"
FT   CDS             complement(58076..58831)
FT                   /transl_table=11
FT                   /gene="pBt073"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNU2"
FT                   /protein_id="CAD30118.1"
FT                   /translation="MVYFKKENEMKYIWDKPTAFILDTNIWLNFLNGSEQGVQTFRKME
FT                   ELIAANKIILFAPEQVLLEWNRHYTSILQQKLTTTKETLDQAKSFIKYFYEPTDNSYHQ
FT                   SLEKIESQIHLNTNIQNPSLCKDIEHLIKNKVTPIKLTNPQLKTMVIEFGLQKKKPFGH
FT                   KNSMGDAVIFFSMYEHFSNKFNNNNQCDYDQIYFVTNDVHDFSEGTDDEKRHILHHDLK
FT                   ELADEIDLNYSDDIHTTINLLKTKKTFNV"
FT   regulatory      complement(58840..58843)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(58963..60012)
FT                   /transl_table=11
FT                   /gene="pBt074"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNU1"
FT                   /protein_id="CAD30119.1"
FT                   /translation="MNNQKSPMFIYTHGLNQIDKDEQHPKSRVKNKINIQKQIQHFQNL
FT                   SLCALLSSDIFVDKTVLTGGSVLNLVYNVHNRVSVDLDLSLESPILPHEYVRLETELEK
FT                   NFDEAFSKEKYKVLNSRLEIRSLNLHNKFSSENLFDPKEILYKYTFQLMDLHEYEEICN
FT                   HPGSTKEQKEARCKDSIIMLPNKKKFFEIDFKWEGPIIEKQEYKIHNYTLEAPSPFILL
FT                   CKKMIGILAHSPHIGDTPEKFKRARSQDFFDIHSLIDAQMIHLQDLIQPNHLSIFQTML
FT                   TEKNIETSSLKDLKKHREFHQSNFTDSVRNMSLFPLKSFEYYFDCIIHLIDYMYPFLTT
FT                   LKSVQSPHS"
FT   regulatory      complement(60020..60024)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(60088..60948)
FT                   /transl_table=11
FT                   /gene="pBt075"
FT                   /product="hypothetical protein"
FT                   /note="Weakly Similar to Yersinia pestis hypothetical 32.3
FT                   kDa protein y1034 or ypmt1.21C TR:O68737 (EMBL:AF053947)
FT                   (291 aa) fasta scores: E(): 0.011, 22.44% id in 303 aa"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNU0"
FT                   /protein_id="CAD30120.1"
FT                   /translation="MALNAQAQFLSILELTKGLLENSPKRLQHLEVFPFHHVEGDSLRY
FT                   VRTPELTPASIIGFGDPIPDNTTIPDEPITFPMSELATSFLVAYKGQDIYSYTNDLVKL
FT                   EEHLATRQLLYKFSEQLESGSNGFLGFTQLIKPSNVTDLNGNTLKLEDLDRAKGQIRVK
FT                   EGESGVIFTNQSGYEQIRKAYYNRDQIPPVIDGKSSFDGWKIYINDFQPTHCIKDKSTT
FT                   NIWFASLGTDALHGIIPENVGDNMFVTRKTVRTEGSEIVVHKTWPVGLALGSQAALASV
FT                   KNVAI"
FT   regulatory      complement(60958..60962)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      61235..61238
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             61249..61800
FT                   /transl_table=11
FT                   /gene="pBt076"
FT                   /product="putative resolvase"
FT                   /note="Similar to Bacillus sphaericus putative resolvase
FT                   tnpR TR:Q9REE7 (EMBL:Y18010) (185 aa) fasta scores: E():
FT                   4e-50, 72.13% id in 183 aa, and to Staphylococcus aureus
FT                   DNA-invertase binr resr or binR SW:BINR_STAAU (P19241) (192
FT                   aa) fasta scores: E(): 1.4e-44, 65.02% id in 183 aa"
FT                   /db_xref="GOA:Q8KNT9"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNT9"
FT                   /protein_id="CAD30121.1"
FT                   /translation="MKIGYVRVSTVDQNLDLQIDALKAYGCDEIFEDKLSGIAGKRPGL
FT                   EKALQYVRPGDSLVVWRLDRLGRTMHHLIQIVNELNEQGVSFYSVQENITMDRSSATGQ
FT                   LMFHLFASFAEFERNLIRERTEAGRIAARARGRFGGRPEKLGEKEQQMIQTLVSKKTPI
FT                   KDIAQILKISRTTVYRYLQK"
FT   misc_feature    61252..61662
FT                   /note="HMMPfam hit to PF00239, Resolvase, N terminal
FT                   domain"
FT   misc_feature    61261..61287
FT                   /note="ScanRegExp hit to PS00397, Site-specific
FT                   recombinases active site."
FT   misc_feature    61411..61449
FT                   /note="ScanRegExp hit to PS00398, Site-specific
FT                   recombinases signature 2."
FT   misc_feature    61666..61797
FT                   /note="HMMPfam hit to PF02796, Helix-turn-helix domain of
FT                   resolvase"
FT   regulatory      61802..61805
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    61813..64716
FT                   /note="HMMPfam hit to PF01526, Transposase"
FT   CDS             61813..64794
FT                   /transl_table=11
FT                   /gene="pBt077"
FT                   /product="transposase"
FT                   /note="Similar to Bacillus anthracis transposase x traX
FT                   TR:Q9XC25 (EMBL:AF150965) (971 aa) fasta scores: E(): 0,
FT                   66.63% id in 971 aa, and to Shigella flexneri tn501
FT                   transposition transposase tnpA TR:AAK18584 (EMBL:AF348706)
FT                   (988 aa) fasta scores: E(): 1.2e-180, 45.74% id in 986 aa"
FT                   /db_xref="GOA:Q8KNT8"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNT8"
FT                   /protein_id="CAD30122.1"
FT                   /translation="MATREVLTQTQREYFYKLSDQVSERERIRYYTLSEEDIQIIRQQR
FT                   GATNQLGFAFQLAYLRFPGRPFASGEKIPDFLVSLLAKRLGIVPAAIHNYAKIRDTTRR
FT                   EHISKIRKHFGFRSFTLREYRELANWLLPTAMGTEKGLVLVDLLIQEMRKRKIILPAMY
FT                   AVEHLVWAVCERAERRTFKKLTKALSPQQLLQLDQLLTKSADKHITNLSWLRKPPGTVS
FT                   LKNFHKILDRVQFIQRLALPLENGQEIHQNRLLQLAREGSRYSTQHLSRFHSMKRYATL
FT                   MAFLIHIYAFLIDQGLYVNEKLLGRMFKRGEKIHNDSFQNDGKLINEKIRLFAKLGKVL
FT                   IEAKEREQDPFVSLQAVIPWDQFVYSVEQAEALARPAEFDYLELLDTYYGQFRKFAPRL
FT                   LQIYTFQSSGITQTLCEALEILKELNTSKKRKVPEFAPMDFIKSKWLKHVLKEDGIDRH
FT                   YYEFSVWTELCNHLRSGDIWVPGSKQYKNFDEYLLPVQTWEEIKRKQQIPLSIATNVDE
FT                   YLQNRCGLMQEQLTMVNQLIRNQELSDVSVYGGHIQIPSLKKDVPDDVADITRAIYDVL
FT                   PRIKLTELLVEVDSWTRFSQQFVHLHTKTGPKDETALFAAILAEGINLGLSKMADACPT
FT                   VTYTQLAWIVDWYISDENYTKALGVLSNFQRQNRHAAHWGNGTTSSSDGQYFRSSGASS
FT                   PLAQVNAKHGRDPGLNFYTHISDQYDPFYAQVISSSEEAPHIIDGLLYHEADTRIEEHY
FT                   TDAAGFVDHVFAMCHMLGFRFSPRIKSIDKTKIYTIDKPTYYPELNFMIGGTIQMKHIR
FT                   DNWDALLRLISSVQNGTVTASLILKKLASYPRQNSLAVALREIGRIERTLYTLEWLQDP
FT                   ALRRRVQVGLNKGEAKHSLARAVCFHRLGEIRDRSYEDQLHRVNGLQLLISVIVIWNTV
FT                   YIEKAIELLRSQGMEIPEEYVQHISPLGWEHIALTGDYIWNVQKKTSIHHLRPLRTKYV
FT                   RNRY"
FT   misc_feature    62641..62709
FT                   /note="1 probable transmembrane helix predicted for pBt077
FT                   by TMHMM2.0"
FT   repeat_region   complement(64891..64908)
FT                   /rpt_type=INVERTED
FT   repeat_region   64891..66545
FT                   /note="IS231F"
FT   CDS             complement(65017..66450)
FT                   /transl_table=11
FT                   /gene="pBt079"
FT                   /product="transposase for insertion sequence IS231F"
FT                   /note="Identical to Bacillus thuringiensis transposase for
FT                   insertion sequence element IS231F SW:T23F_BACTI (Q02404)
FT                   (477 aa) fasta scores: E(): 3.6e-192, 100% id in 477 aa"
FT                   /db_xref="GOA:Q7AL69"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AL69"
FT                   /protein_id="CAD30123.1"
FT                   /translation="MNLSIQEELQPFVEELQRYITPEFLEELAREMKFVKRKRKFSGSD
FT                   LATICIWISQRVASDPLVRLCSRLHAVTGTVLSPEGLNKRFNEKSVLFLKHVFSLLLQQ
FT                   KICEQTYISNQLLSHFKRIRIMDATMFQVPHTLEHIYPGSGGCAQTAGIKIQLEYDLHS
FT                   GQFFNFQVGPGKNNDKTFGTECLDTLRPGDLCIRDLGYFSLEDLDQMDQRGTYYISRLK
FT                   LNTNVYVKNPSPEYFKNGAIKKQSEYIQINVIQILNQLQPGETIEYQQAYIGDKQQLFS
FT                   RLVFHRLTAAQLQKRLKKIAEKEKSKHRTYSEKSKLVAGLNVYVTNAPWEWVPMEQVHE
FT                   LYTLRWQIEIVFKTWKSLFDIDHCRTVKQERIECHLYGKLIAIFLCSSTMFKMRQLLLQ
FT                   KKKKELSEYKAIGMIQDHLFLLYQSIQNTQEITKLLTRLFHLLQQNGRKSHRYEKKTVF
FT                   DIMGVIYEYSGCSKQKKAA"
FT   misc_feature    complement(65296..66090)
FT                   /note="HMMPfam hit to PF01609, Transposase (IS4 family)"
FT   repeat_region   66528..66545
FT                   /rpt_type=INVERTED
FT   repeat_region   66563..67075
FT                   /note="IS946-like"
FT   repeat_region   67063..67075
FT                   /rpt_type=INVERTED
FT   CDS             complement(join(67497..68342,68342..68911))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pBt082"
FT                   /product="probable transposase (pseudogene)"
FT                   /note="Similar to Streptococcus pyogenes transposase-is1562
FT                   spy2013 TR:Q99XV1 (EMBL:AE006623) (401 aa) fasta scores:
FT                   E(): 1.2e-49, 39.13% id in 391 aa, and in N-terminus to
FT                   Bacillus anthracis pxo1-120 TR:Q9X379 (EMBL:AF065404) (190
FT                   aa) fasta scores: E(): 1.4e-71, 97.36% id in 190 aa"
FT   regulatory      complement(68921..68926)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(69159..70286)
FT                   /transl_table=11
FT                   /gene="pBt084"
FT                   /product="putative spore germination protein"
FT                   /note="Similar to Bacillus subtilis spore germination
FT                   protein A3 precursor gerAC or gerA3 SW:GRAC_BACSU (P07870)
FT                   (373 aa) fasta scores: E(): 3.2e-07, 23.51% id in 387 aa,
FT                   and to Bacillus subtilis spore germination protein B3
FT                   precursor gerBC SW:GRBC_BACSU (P39571) (374 aa) fasta
FT                   scores: E(): 2.3e-06, 21.83% id in 371 aa"
FT                   /db_xref="GOA:Q8KNT7"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNT7"
FT                   /protein_id="CAD30125.1"
FT                   /translation="MIRKWIGIVISCMYLIGCSQRIPLEQASLILLIALDRTPNGEIQV
FT                   GTSIPLFHHEKQKSTVEHWVQASTIYEGFSKMDTKLIGFVTSSKSEVILIGKKFAQEEN
FT                   WIQALDSSYRDPYATINAKVVIVDGSPKSILKIHRPDKPALSSYISGVIEASIQNNQSV
FT                   SSTIQQLMREKNEKGMTQTVPIIKKINNEIDTVGIAFLDPKGKYLTKISKNDVKFFNLI
FT                   NKSKSKGRIILHVVLSPKKSIQKPNTSVLVQDAKRKINVDFQKGKFIFNINMSMNVSLI
FT                   EKTNGNITKNRLYSSKHINKLEHEIQEEINEKLQSMLQDMQRNKIDPIGLSVYARAFQY
FT                   KEWKKVKEDWLQTLSKAKICVNTQVKIKDTGTIRN"
FT   CDS             complement(70283..71395)
FT                   /transl_table=11
FT                   /gene="pBt085"
FT                   /product="putative spore germination protein"
FT                   /note="Similar to Bacillus cereus spore germination protein
FT                   GeriB geriB TR:O85468 (EMBL:AF067645) (364 aa) fasta
FT                   scores: E(): 1.3e-20, 25.56% id in 352 aa, and to Bacillus
FT                   subtilis spore germination protein b2 gerbB SW:GRBB_BACSU
FT                   (P39570) (368 aa) fasta scores: E(): 9e-12, 22.19% id in
FT                   365 aa"
FT                   /db_xref="GOA:Q8KNT6"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNT6"
FT                   /protein_id="CAD30126.1"
FT                   /translation="MVHLGKVNFRNLTLLEFIIFIHSLQLASGMLIMPSPLAATAGTDG
FT                   WISIILGWIITSIIGVLIILMLQKNPNKNFTQVLTTYFGKWLGAIFLFLYAFYLFFAAF
FT                   NTLLKATDIVKVWIFPSIPTYQIVILLLLPFIILAQSGIRALTSYSMLVFFFTAWMPIL
FT                   LLFALKSNYNPLHLLPILKDGIYPIVRATKETITPYAGLEIAYFIYPFLQKKEKAIKGI
FT                   LIANTGTMFFYIYATILTYIYFSPEGIKDVIWPVFHLLKGIRFSFIERLEIIYIAYYLI
FT                   VFSTTIYPYLFFSLHSMTTICSRISRNWIIVSSILLIVGVFTFFNPNLNQIVFIYFLMD
FT                   IFNIIFFVLFPVFLFIYSILFTWLTRRKQL"
FT   regulatory      complement(70294..70297)
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(join(70304..70369,70415..70471,70511..70576,
FT                   70664..70729,70769..70834,70895..70960,70982..71047,
FT                   71093..71158,71195..71260,71291..71356))
FT                   /note="10 probable transmembrane helices predicted for
FT                   pBt085 by TMHMM2.0"
FT   misc_feature    complement(70322..71359)
FT                   /note="ProfileScan hit to PS50286, Permeases for amino
FT                   acids and related compounds, family II."
FT   CDS             complement(71373..72881)
FT                   /transl_table=11
FT                   /gene="pBt086"
FT                   /product="putative spore germination protein"
FT                   /note="Similar to Bacillus subtilis spore germination
FT                   protein KA gerKA SW:GRKA_BACSU (P49939) (544 aa) fasta
FT                   scores: E(): 1.7e-59, 38.21% id in 458 aa, and to Bacillus
FT                   cereus spore germination protein GeriA gerIA SW:GRIA_BACCE
FT                   (O85467) (663 aa) fasta scores: E(): 1.9e-58, 35.81% id in
FT                   483 aa"
FT                   /db_xref="GOA:Q8KNT5"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNT5"
FT                   /protein_id="CAD30127.1"
FT                   /translation="MSLIERTIKTTMNEIVETIQTNNLQELKNKLEQIFDICADLVEHP
FT                   LQLKTKTNVVLYYFEGLTDGVTLKGSVITPLLQEVTEDIQVFNSDTIATYTKTVCTWNE
FT                   IKKGLLEGQCVLFMEGARKALLINTKGWAERSIQEPVSEVTIKGSHDGFIENAAKNIGL
FT                   IRRYIPSTELKIKKLAVGERATTFVYLLYLGDVANADVVQEVEGRISKIKIDTVLGIGE
FT                   LSNLTKDNSLTPFPQAYLSERPDAISNHILDGKVAVLVDRSPSAMIVPINLIGFFQTPD
FT                   DYNVHWMIASFFRLLRFLGFIIAMFLPAMYIAMVSFHFEIIPLDLYTSIATSRIKVPFS
FT                   PLLEALIMEITLEMLREAGIRLPQPIGQTIGIVGGIVIGQAAVQAGLVSNVMVIIVSIT
FT                   AISSFVVSNYDLSSCIRLIRFPMMLFAYFYGIVGIVSGLMLLFAHFVSLTSYGSPYGLP
FT                   IAPFRFQELKDSFVRFPNSMLTTRSSTGQPKQKKKKEGGSPGEG"
FT   misc_feature    complement(join(71544..71609,71661..71726,71931..71996))
FT                   /note="3 probable transmembrane helices predicted for
FT                   pBt086 by TMHMM2.0"
FT   regulatory      complement(72887..72893)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(join(73282..74418,74422..74679))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pBt087"
FT                   /product="putative 1-phosphatidylinositol phosphodiesterase
FT                   precursor"
FT                   /EC_number="3.1.4.10"
FT                   /note="Similar to Listeria monocytogenes
FT                   1-phosphatidylinositol phosphodiesterase precursor plcA or
FT                   pic or LMO0201 SW:PLC_LISMO (P34024) (317 aa) fasta scores:
FT                   E(): 8.8e-17, 34.02% id in 288 aa, and to Bacillus
FT                   thuringiensis 1-phosphatidylinositol phosphodiesterase
FT                   precursor SW:PLC_BACTU (P08954) (329 aa) fasta scores: E():
FT                   2.4e-14, 27.69% id in 325 aa. Contains an in-frame TGA stop
FT                   after aa 86. The sequence has been checked, and is believed
FT                   to be correct."
FT   misc_feature    complement(74074..74346)
FT                   /note="HMMPfam hit to PF00388,
FT                   Phosphatidylinositol-specific phospholipase C, X domain"
FT   misc_feature    complement(74086..74349)
FT                   /note="ProfileScan hit to PS50007,
FT                   Phosphatidylinositol-specific phospholipase X-box domain
FT                   profile."
FT   misc_feature    complement(74602..74679)
FT                   /note="Signal peptide predicted for pBt088 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.997 between residues 26 and 27"
FT   regulatory      complement(74687..74692)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(75075..75656)
FT                   /transl_table=11
FT                   /gene="pBt089"
FT                   /product="putative exported protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNT4"
FT                   /protein_id="CAD30129.1"
FT                   /translation="MKVMKKKQRMIVTAAMAATLATGALPTTSAFAAETKAPIQQQESQ
FT                   MGIQPFSQSNLETAVKAALYGPEVKKIKVFEHEFNVKPIEVVDLGGGKKYVKGQISHHL
FT                   SFRPDDQVYYEFTVKDGEVIGTPQYHIDRGGFTPFAAPLLSIIAAYNGIPVNPNDLNTL
FT                   GQQIGKVIDGSWEHAAQSIATVVSLSFNEK"
FT   misc_feature    complement(75561..75656)
FT                   /note="Signal peptide predicted for pBt089 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.994 between residues 41 and 42"
FT   regulatory      complement(75659..75663)
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   complement(76106..76118)
FT                   /rpt_type=INVERTED
FT   repeat_region   76106..76904
FT                   /note="IS946-like"
FT   regulatory      76159..76163
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             76167..76853
FT                   /transl_table=11
FT                   /gene="pBt090"
FT                   /product="IS element transposase"
FT                   /note="Similar to Enterococcus faecium transposase
FT                   TR:Q47818 (EMBL:U49512) (226 aa) fasta scores: E():
FT                   5.3e-51, 58.22% id in 225 aa, and to Lactobacillus sakei
FT                   putative is1519r transposase tnp1519R TR:Q9AEC6
FT                   (EMBL:Z54312) (228 aa) fasta scores: E(): 8.3e-51, 58.22%
FT                   id in 225 aa"
FT                   /db_xref="GOA:Q8KNT3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNT3"
FT                   /protein_id="CAD30130.1"
FT                   /translation="MGYFKGKQFKKDIILVAVGYYCRFSLSYRDVSEILKEQGVSVHPT
FT                   TIMRWVHEYGNLIYQIWKKKNQSAHHVWHVDETYIKVKGEWSYLYRAIDSNGYTLDFQL
FT                   RKTRDHQAAYAFIKRLTKQFGEPTVLTTDQAPALLCAFKKLKNNGFYVHITHCTVKHLN
FT                   NLIEQDHRHVKRRFAKSSGFQNIRHASRTLKGIETIHAIYKQKRSQIPDFSFSTYKELQ
FT                   ELFRTA"
FT   misc_feature    76359..76766
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   76892..76904
FT                   /rpt_type=INVERTED
FT   CDS             complement(76925..77266)
FT                   /transl_table=11
FT                   /gene="pBt091"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="Similar to Bacillus anthracis transcriptional
FT                   repressor pagR or tcrA or pXO1-109 TR:O31178
FT                   (EMBL:AF031382) (99 aa) fasta scores: E(): 1.4e-11, 51.8%
FT                   id in 83 aa, and to Bacillus anthracis pXO1-138 TR:Q9X394
FT                   (EMBL:AF065404) (97 aa) fasta scores: E(): 1.4e-10, 46.06%
FT                   id in 89 aa, and to Vibrio cholerae transcriptional
FT                   activator hlyU or VC0678 SW:HLYU_VIBCH (P52695) (108 aa)
FT                   fasta scores: E(): 0.00029, 32.6% id in 92 aa"
FT                   /db_xref="GOA:Q8KNT2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNT2"
FT                   /protein_id="CAD30131.1"
FT                   /translation="MRKYPKKRMRRKKMTNVFYMELNDLNYELERSAEILRVLAHPFRL
FT                   QIVHQLLEKNALNVTELQKILKLPQSTVSQHLHKMRNHKVLSHERKGTEVFYRVDDKQV
FT                   KQTVHILMG"
FT   misc_feature    complement(76928..77161)
FT                   /note="HMMPfam hit to PF01022, Bacterial regulatory
FT                   protein, arsR family"
FT   misc_feature    complement(76928..77167)
FT                   /note="HMMSmart hit to SM00418, helix_turn_helix, Arsenical
FT                   Resistance Operon Repressor, DNA-binding"
FT   misc_feature    complement(76970..77017)
FT                   /note="FPrintScan hit to PR00778, Bacterial regulatory
FT                   protein ArsR family signature"
FT   misc_feature    complement(77015..77062)
FT                   /note="FPrintScan hit to PR00778, Bacterial regulatory
FT                   protein ArsR family signature"
FT   misc_feature    complement(77114..77161)
FT                   /note="FPrintScan hit to PR00778, Bacterial regulatory
FT                   protein ArsR family signature"
FT   misc_feature    77382..77651
FT                   /note="HMMPfam hit to PF00216, Bacterial DNA-binding
FT                   protein"
FT                   /note="HMMSmart hit to SM00411, bacterial (prokaryotic)
FT                   histone like domain"
FT   CDS             77382..77660
FT                   /transl_table=11
FT                   /gene="pBt092"
FT                   /product="small DNA-binding protein (bacterial histone-like
FT                   family)"
FT                   /note="Similar to Bacillus subtilis DNA-binding protein HU
FT                   1 hupA or hbs or hbsU or dbpA SW:DBH1_BACSU (P08821) (92
FT                   aa) fasta scores: E(): 5.1e-19, 63.04% id in 92 aa, and to
FT                   Streptococcus thermophilus DNA-binding protein HU hup or
FT                   hstH SW:DBH_STRTR (P96045) (91 aa) fasta scores: E():
FT                   1.2e-16, 61.36% id in 88 aa"
FT                   /db_xref="GOA:Q8KIW0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KIW0"
FT                   /protein_id="CAD30132.1"
FT                   /translation="MNKSELIKQVAIQSELKKPQASLAVDAVLESIQHALQNGDHVQLF
FT                   GFGSFEVKERAAREGRNPHTGEALTIPAGKTPAFKAGKALKEAVNAK"
FT   misc_feature    77385..77648
FT                   /note="BlastProDom hit to PD000945, PD000945"
FT   misc_feature    77517..77576
FT                   /note="ScanRegExp hit to PS00045, Bacterial histone-like
FT                   DNA-binding proteins signature."
FT   CDS             complement(77713..77901)
FT                   /transl_table=11
FT                   /gene="pBt093"
FT                   /product="HfQ protein (RNA-binding protein)"
FT                   /note="Similar to Bacillus subtilis HfQ protein hfQ
FT                   SW:HFQ_BACSU (O31796) (73 aa) fasta scores: E(): 3.4e-09,
FT                   46.55% id in 58 aa, and to Escherichia coli Hfq protein
FT                   b4172 or z5779 SW:HFQ_ECOLI (P25521) (101 aa) fasta scores:
FT                   E(): 0.00076, 36.2% id in 58 aa"
FT                   /db_xref="GOA:Q8KNT1"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNT1"
FT                   /protein_id="CAD30133.1"
FT                   /translation="MLSLQEQLLQEAFQKRKDITLILLKGLHVKGIIRGFDTYSVLIEV
FT                   EGKQQLVYKHAISTIRF"
FT   regulatory      complement(77915..77919)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(77968..78249)
FT                   /transl_table=11
FT                   /gene="pBt094"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Bacillus subtilis transcription state
FT                   regulatory protein abrB or cpsX SW:ABRB_BACSU (P08874) (96
FT                   aa) fasta scores: E(): 1.5e-17, 62.06% id in 87 aa, and to
FT                   Bacillus subtilis putative transition state regulator Abh
FT                   abh SW:ABH_BACSU (P39758) (92 aa) fasta scores: E():
FT                   1.1e-16, 56.32% id in 87 aa, and to Bacillus subtilis stage
FT                   V sporulation protein T spoVT SW:SP5T_BACSU (P37554) (178
FT                   aa) fasta scores: E(): 1e-07, 70% id in 50 aa"
FT                   /db_xref="GOA:Q8KNT0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNT0"
FT                   /protein_id="CAD30134.1"
FT                   /translation="MKATGIVRKIDELGRIVIPRETRRTLNIHEKEPLEIFVEGETIIL
FT                   QKYQSYGTCPITGEISSQNIKLADGKLTLSPEGAKQLMEELEQYKVTV"
FT   regulatory      complement(78258..78263)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      78361..78365
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             78371..78637
FT                   /transl_table=11
FT                   /gene="pBt095"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Bacillus subtilis YnzD protein ynzD
FT                   TR:O31819 (EMBL:Z99113) (57 aa) fasta scores: E(): 0.12,
FT                   41.86% id in 43 aa, and to Bacillus halodurans Bh1743
FT                   protein bh1743 TR:Q9KC31 (EMBL:AP001513) (44 aa) fasta
FT                   scores: E(): 0.18, 48.57% id in 35 aa"
FT                   /db_xref="GOA:Q8KH11"
FT                   /db_xref="InterPro:IPR018540"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KH11"
FT                   /protein_id="CAD30135.1"
FT                   /translation="MSTSDVTHLQKQIEEKKKQLRQLVRAYGYTDPLIFACSQELDQLV
FT                   YRFMRDYSPQKVTCKKRFQFINRIGISLYICPLYFTITGVYVD"
FT   misc_feature    78563..78631
FT                   /note="1 probable transmembrane helix predicted for pBt095
FT                   by TMHMM2.0"
FT   CDS             complement(78790..79689)
FT                   /transl_table=11
FT                   /gene="pBt096"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical
FT                   transmembrane protein smc01970 TR:CAC47083 (EMBL:AL591790)
FT                   (281 aa) fasta scores: E(): 2.6e-25, 37.36% id in 273 aa,
FT                   and to Pseudomonas carboxydovorans CoxK protein coxK
FT                   TR:Q9KX21 (EMBL:X82447) (296 aa) fasta scores: E():
FT                   1.1e-24, 34.71% id in 265 aa"
FT                   /db_xref="GOA:Q8KH10"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KH10"
FT                   /protein_id="CAD30136.1"
FT                   /translation="MIRNNETKYILLVFLAICFLATGGIFVKLSELPPINTGFYRVLLS
FT                   IPLLLPFVWKELNKVSKKDILLILLAGVFLAGDLILWNVSFYYTSVANANLLANLVPLV
FT                   IIPFSFFIFKEKITRTFFIGAIITISGVIVLVSGKAVITTDNLFGDMLAFLTAFFYAFF
FT                   LLTVYKVRERVSASIIMFVSAFGSAVTIFIALLFTEGVYIPSSSSEWLPLIGLAIFSQI
FT                   LGQGLLSFCLGKVNVALSSILVLLQPIVAAIYAWFIFTQKLTIVEIMGMVISLVGIYIV
FT                   KMKKKQKVSNKSKEKIVS"
FT   misc_feature    complement(78841..79227)
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6"
FT   misc_feature    complement(join(78847..78900,78913..78978,78994..79059,
FT                   79099..79164,79186..79251,79264..79329,79351..79416,
FT                   79429..79494,79528..79578))
FT                   /note="9 probable transmembrane helices predicted for
FT                   pBt096 by TMHMM2.0"
FT   misc_feature    complement(79279..79641)
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6"
FT   misc_feature    complement(79603..79689)
FT                   /note="Signal peptide predicted for pBt096 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.979) with cleavage site
FT                   probability 0.711 between residues 29 and 30"
FT   regulatory      complement(79696..79700)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(80052..81215)
FT                   /transl_table=11
FT                   /gene="pBt097"
FT                   /product="putative class-II aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="Similar to Bacillus subtilis putative
FT                   aminotransferase B patB SW:PATB_BACSU (Q08432) (387 aa)
FT                   fasta scores: E(): 2e-70, 43.52% id in 386 aa"
FT                   /db_xref="GOA:Q8KNS9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNS9"
FT                   /protein_id="CAD30137.1"
FT                   /translation="MKLDFDQQIDRLYTASYKWDQSKILFETEDILPMWVADMDFMSPP
FT                   AVVNALINRATHGVYGYTIIPDSYYSSIIDWLKRRHGSMVQKEWITHSPGVVTALSILV
FT                   SCLTKPGDKVMIQSPVYHPFYDVVLQQNRELVTNNLILEDGRYTMDLKDLENKIDSSVK
FT                   VMLLCNPHNPVGRVWDEQELERLGALCAKHNIIVISDEIHCDLIYKGNKHVPFSSISEK
FT                   MKSTSITCISTSKTFNLAGLKTCNLIIQNPHIKEVYEKKLKMLSLHSESFFGITAVEAA
FT                   YTHGEEWLNQLLIYLEGNLNFLLDYFKQHINEVKVIKPEGTYLVWLDFRGLRMNKENIE
FT                   KWMYQKAKLALNEGSMFGENGKGFLRMNIACPRATLEEGLSRIRKEL"
FT   misc_feature    complement(80055..80993)
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II"
FT   misc_feature    complement(80562..80633)
FT                   /note="FPrintScan hit to PR00753,
FT                   1-aminocyclopropane-1-carboxylate synthase signature"
FT   misc_feature    complement(80667..80741)
FT                   /note="FPrintScan hit to PR00753,
FT                   1-aminocyclopropane-1-carboxylate synthase signature"
FT   misc_feature    complement(80820..80885)
FT                   /note="FPrintScan hit to PR00753,
FT                   1-aminocyclopropane-1-carboxylate synthase signature"
FT   misc_feature    complement(80889..80951)
FT                   /note="FPrintScan hit to PR00753,
FT                   1-aminocyclopropane-1-carboxylate synthase signature"
FT   CDS             complement(81250..82290)
FT                   /transl_table=11
FT                   /gene="pBt098"
FT                   /product="Pyridoxal-phosphate dependent enzyme"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   40.1 kDa protein cysm3 or rv0848 or mtv043.41 TR:O53860
FT                   (EMBL:AL022004) (372 aa) fasta scores: E(): 6.6e-40, 38.62%
FT                   id in 334 aa, and to Clostridium sticklandii O-acetylserine
FT                   sulfhydrylase cysK TR:Q9L4R2 (EMBL:AJ130879) (304 aa) fasta
FT                   scores: E(): 8.7e-25, 33.22% id in 310 aa, and to Spinacia
FT                   oleracea cysteine synthase, chloroplast precursor cysK
FT                   SW:CYSL_SPIOL (P32260) (383 aa) fasta scores: E(): 3.9e-24,
FT                   29.96% id in 317 aa, and to Bacillus subtilis probable
FT                   cysteine synthase ytkP SW:CYSM_BACSU (O34476) (311 aa)
FT                   fasta scores: E(): 1e-23, 32.34% id in 303 aa"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNS8"
FT                   /protein_id="CAD30138.1"
FT                   /translation="MMLRENIVDAIGNTPLVQLQLDSSARGNVFAKLEMLNPFGMKDRA
FT                   AKKVILEAKKNGVLKDGAPIIESSSGTMALGLAMVGTYLGHPVHIVTDKRTDQMTLAKL
FT                   KSLGCKLEIVTEMTHLGWQSARLDRLEEILKENKEAFCPRQYENSDNPNAYESLADEAL
FT                   EELGHIDILVASVGSGGSLCGTARALKKANPDLRVVAVDAVGSVIFNQPDIPGRLQGGH
FT                   GNSVIPKNVDFSIIDEVHWLNDEECYAANLELAKCEKLFAGNSSAASYAVSRFLSSRCS
FT                   EETNILTIFPDRGDRYYKTVYNEEYRKEKGMTNLNLHKQPKKVSYGMTVTSWSYASLQD
FT                   NKMLTF"
FT   misc_feature    complement(81412..82272)
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme"
FT   misc_feature    complement(81673..82251)
FT                   /note="ProfileScan hit to PS50148, Pyridoxalphosphate
FT                   dependent enzymes."
FT   regulatory      complement(82295..82299)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(82359..82469)
FT                   /transl_table=11
FT                   /gene="pBt099"
FT                   /product="hypothetical hydrophobic protein"
FT                   /note="no database matches"
FT                   /db_xref="GOA:Q8KH09"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KH09"
FT                   /protein_id="CAD30139.1"
FT                   /translation="MLVTVGPSLYCISIVGGGCILLSGILEVILEKKEDY"
FT   misc_feature    complement(82383..82448)
FT                   /note="1 probable transmembrane helix predicted for pBt099
FT                   by TMHMM2.0"
FT   CDS             complement(82595..83302)
FT                   /transl_table=11
FT                   /gene="pBt100"
FT                   /product="tRNA synthetase-related protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa2106 pa2106 TR:Q9I209 (EMBL:AE004638) (244 aa)
FT                   fasta scores: E(): 6.6e-14, 30.95% id in 252 aa, and to
FT                   Homo sapiens alanyl-tRNA synthetase aarS SW:SYA_HUMAN
FT                   (P49588) (968 aa) fasta scores: E(): 3.9e-06, 29.44% id in
FT                   163 aa"
FT                   /db_xref="GOA:Q8KIV9"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KIV9"
FT                   /protein_id="CAD30140.1"
FT                   /translation="MVRKLYLQDPYLQECNAIITKIEDNKIFLNQTVFYPEGGGQIGDQ
FT                   GWIEGNEVIDTQKTGGNLFYHSNFPIIKVGSEVAHILKEPVKGLREGMEVKAKINWERR
FT                   HMLMRMHAAAHLVYYYTFQVFGEMYVKGCHIAEDRARFDFYSPDKRLDREGLDKVEEFA
FT                   NLIVTDNIPIKNIPLNEEPEAINWICGDMHIPCGGTHVRQTGDIGEISVRRNSRGKNLE
FT                   RMYLEIGGGDSFK"
FT   misc_feature    complement(82781..83218)
FT                   /note="HMMPfam hit to PF01411, tRNA synthetases class II
FT                   (A)"
FT   CDS             complement(83350..84249)
FT                   /transl_table=11
FT                   /gene="pBt101"
FT                   /product="possible kinase"
FT                   /note="Similar to Streptomyces rishiriensis gene in
FT                   coumermycin A1 biosynthetic gene cluster Cour3 TR:Q9F8T5
FT                   (EMBL:AF235050) (302 aa) fasta scores: E(): 1.3e-30, 35.29%
FT                   id in 272 aa, and to Salmonella enterica subspenterica
FT                   serovar Typhimurium gene in propanediol utilization (pdu)
FT                   operon pduX TR:Q9XDM4 (EMBL:AF026270) (300 aa) fasta
FT                   scores: E(): 4.5e-11, 23.82% id in 277 aa, and to
FT                   Hyphomicrobium chloromethanicum monophosphate kinase
FT                   TR:Q9APK3 (EMBL:AF281259) (185 aa) fasta scores: E():
FT                   0.015, 28.57% id in 133 aa, and to Pyrococcus horikoshii
FT                   mevalonate kinase mvk or ph1625 SW:KIME_PYRHO (O59291) (335
FT                   aa) fasta scores: E(): 0.077, 25.92% id in 216 aa"
FT                   /db_xref="GOA:Q8KNS7"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012363"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNS7"
FT                   /protein_id="CAD30141.1"
FT                   /translation="MIVSRENDSIMKEAISATGVGISCGTCGELVQGCINDQNFMITFP
FT                   IPLYASAEARFVRGGKISIIPGYKNKAAKAAEILVDSLRKLGIVDKELGITIKIESELM
FT                   EGKGMASSTADIIAVCRAISNLCNYPIGPWEISNICTSIEPSDGVMYQSSVVYDFFKGR
FT                   LLEDIGPLMSMRLVIVDNGEAVDTVNFKRVPYTPKEMKQVLEAYRLATCAIKSKDIELL
FT                   GRATTISAKVNQRRHFKKEFNDIMNIFPELGAHGISVAHSGSILSLLFDANDDMKIEHA
FT                   KNRISMMFPEATIREITI"
FT   regulatory      complement(84258..84264)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      84363..84367
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             84375..85817
FT                   /transl_table=11
FT                   /gene="pBt102"
FT                   /product="GntR-family transcritional regulator contaniing
FT                   aminotransferase domain"
FT                   /note="Similar to Bacillus halodurans transcriptional
FT                   regulator bh0432 TR:Q9KFP6 (EMBL:AP001508) (482 aa) fasta
FT                   scores: E(): 7.4e-62, 36.4% id in 478 aa, and to
FT                   Thermococcus profundus multiple substrate aminotransferase
FT                   TR:Q9V2W5 (EMBL:AB027131) (417 aa) fasta scores: E():
FT                   1e-35, 29.41% id in 391 aa"
FT                   /db_xref="GOA:Q8KNS6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNS6"
FT                   /protein_id="CAD30142.1"
FT                   /translation="MEWKLDNDCKIPIYQQVIDFIERRITYGELPPGSLLPSERKLATH
FT                   LHVNRSTVTIAYNELRAMGIVESTTGRGTRVSTHMWGVSPTLTPNWKSFVEGGTFSPNL
FT                   PLLRHIRAQVQQNENMIDFASGELGCNLFPHEQLQAILREQPLTQSLSYDHPQGYLPLR
FT                   QTVVKYMKDYLKVKATEQSIMITSGAQQALHLIVQCLLNPGDAVAFESPSHCYSLPLFQ
FT                   SAGIRIFPLPVDEHGINPNDVQELYRKHRIKMIFLNPNFQNPTGTMLRPNRRKKLLSLC
FT                   ADLRIAIVEDDPSSLLTLEKKQPCPTLKSIDENGTVIYIHSLSKMIAPGLRIGWLVAPQ
FT                   SVVERLADARNQMELGMSIFPQWLIQQFFETIPFQSHIEPLRKQLGEKRDIIVRALNEQ
FT                   LQDKISFSNPNGGMYIWGKLNKPINEKQLIMQSLKNEIAFMPGSIFGAKNGYIRLSYGK
FT                   VNRYQIEEGISRLREAITICEE"
FT   misc_feature    84423..84602
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family"
FT                   /note="HMMSmart hit to SM00345, helix_turn_helix gluconate
FT                   operon transcriptional repressor, DNA-binding"
FT   misc_feature    84480..84524
FT                   /note="FPrintScan hit to PR00035, GntR bacterial regulatory
FT                   protein HTH signature"
FT   misc_feature    84480..84554
FT                   /note="ScanRegExp hit to PS00043, Bacterial regulatory
FT                   proteins, gntR family signature."
FT   misc_feature    84522..84572
FT                   /note="FPrintScan hit to PR00035, GntR bacterial regulatory
FT                   protein HTH signature"
FT   misc_feature    84876..85799
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II"
FT   repeat_region   complement(85941..85957)
FT                   /rpt_type=INVERTED
FT   repeat_region   85941..86801
FT                   /note="IS240"
FT   CDS             86032..86739
FT                   /transl_table=11
FT                   /gene="pBt103"
FT                   /product="insertion sequence IS240 protein"
FT                   /note="Similar to Bacillus thuringiensis insertion element
FT                   is240-b protein TR:Q45767 (EMBL:M23741) (235 aa) fasta
FT                   scores: E(): 1.2e-90, 100% id in 235 aa"
FT                   /db_xref="GOA:Q7AL68"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AL68"
FT                   /protein_id="CAD30143.1"
FT                   /translation="MEKENIFKWKHYQADMILWTVRWYLRYNLSFRDLVEMMEERGLSL
FT                   SHTTIMRWVHQYGPELNERIRKHLKRTNDSWRVEETYIKIKGENMYLYRAVDSEGNTLD
FT                   FYLSKKRDEKAAKCFLKKALASFHVTKPRVITVDGNKAYPVAIRELKNEKSISYGMPLR
FT                   VKKYLNNMIEQDHRFIKKRIRNMLGLKSMQTAVKMIAGIEAMHMVKKGQLKLRAQSAQN
FT                   QNRCIHQLFGLTA"
FT   misc_feature    86233..86628
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   86785..86801
FT                   /rpt_type=INVERTED
FT   CDS             complement(join(86947..88815,88819..90000))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pBt104"
FT                   /product="transposase (pseudogene)"
FT                   /note="Similar to Pseudomonas putida tn4652 transposase
FT                   tnpA TR:P72226 (EMBL:X83686) (1004 aa) fasta scores: E():
FT                   3.6e-99, 36.28% id in 1028 aa, and to Enterococcus faecium
FT                   transposase for transposon tn1546 SW:TNP6_ENTFC (Q06238)
FT                   (988 aa) fasta scores: E(): 8.9e-46, 25.18% id in 973 aa.
FT                   Contains an in-frame stop codon after aa 394"
FT   misc_feature    complement(87025..88575)
FT                   /note="HMMPfam hit to PF01526, Transposase"
FT   regulatory      complement(90008..90012)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(90061..90633)
FT                   /transl_table=11
FT                   /gene="pBt106"
FT                   /product="resolvase"
FT                   /note="Similar to Enterococcus faecium transposon tn1546
FT                   resolvase SW:TNR6_ENTFC (Q06237) (191 aa) fasta scores:
FT                   E(): 2.8e-53, 76.72% id in 189 aa, and to Clostridium
FT                   perfringens ReSolvase res SW:RESP_CLOPE (P07945) (189 aa)
FT                   fasta scores: E(): 2.5e-27, 47.34% id in 188 aa"
FT                   /db_xref="GOA:Q8KNS5"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNS5"
FT                   /protein_id="CAD30145.1"
FT                   /translation="MRKIGYVRVSSVDQNPKRQLQQMEEIGVDIIYQEKVSGATQDRPE
FT                   LQNMLGNLKEGDIIYVTDLTRITRSTRDLFELVDYIKNKQANLKSLKDTWLDLSEENPY
FT                   SHFLMTVMGGVNQLERDLIRMRQREGITLAKKEGKYQGRVKKYHEKHAGMNYAMKLYEE
FT                   GNMTVKQICEITSVSRSSLYRKIHDLG"
FT   misc_feature    complement(90067..90210)
FT                   /note="HMMPfam hit to PF02796, Helix-turn-helix domain of
FT                   resolvase"
FT   misc_feature    complement(90214..90633)
FT                   /note="HMMPfam hit to PF00239, Resolvase, N terminal
FT                   domain"
FT   misc_feature    complement(90592..90618)
FT                   /note="ScanRegExp hit to PS00397, Site-specific
FT                   recombinases active site."
FT   regulatory      complement(90642..90647)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(90865..91842)
FT                   /transl_table=11
FT                   /gene="pBt107"
FT                   /product="conserved hypothetical protein"
FT                   /note="Weak similar in N-terminus to Bacillus halodurans
FT                   Bh0264 protein TR:Q9KG49 (EMBL:AP001507) (213 aa) fasta
FT                   scores: E(): 1.1, 22.88% id in 201 aa"
FT                   /db_xref="GOA:Q8KNS4"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNS4"
FT                   /protein_id="CAD30146.1"
FT                   /translation="MNCYDKGFVQAFIDGELPHDKRKEFTKHLDTCEVCQNTLLEISKL
FT                   NQWEHVMLEDETIHSSQDINIDIDQAWKTFESRTKLENVSYINEKTEQKKGLFTNMDKK
FT                   SKRFMYAVVAVAGLFTTAMIPQVRVAATNVASYFSNEVSNDKVVNEGMQDENGVTQDMM
FT                   KNGQYIPIDEKITDQGVTVHFKELYVADSRISVHYKIEKADGSLVPYEFDTTGLNLKSE
FT                   GKENGQQEENPEYYGKDGSFSQLPFIQGENGLPFKLKAAGQELDHVGIRDKDRPESVLT
FT                   FVEGPEGKDSFKQPLTLDVNINKIGKVSGSWKGQILIDSSKLQK"
FT   misc_feature    complement(91453..91518)
FT                   /note="1 probable transmembrane helix predicted for pBt107
FT                   by TMHMM2.0"
FT   CDS             complement(91846..92376)
FT                   /transl_table=11
FT                   /gene="pBt108"
FT                   /product="putative sigma factor, ECF-family"
FT                   /note="Similar to Bacillus subtilis RNA polymerase sigma
FT                   factor SigY sigY SW:SIGY_BACSU (P94370) (178 aa) fasta
FT                   scores: E(): 4.9e-05, 23.07% id in 169 aa, and to Bacillus
FT                   subtilis RNA polymerase sigma factor SigX sigX
FT                   SW:SIGX_BACSU (P35165) (194 aa) fasta scores: E(): 0.00014,
FT                   23.81% id in 168 aa"
FT                   /db_xref="GOA:Q8KNS3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNS3"
FT                   /protein_id="CAD30147.1"
FT                   /translation="MLKIKKEERPVSDLTFEDLFKQYYVYVVKQILWIVKNQPIAEELA
FT                   QEVFLQLYRNDWKTIESLPGWLIKSSTYVAYKYLRSEKRHQARIDKTIQHHEVQPISSL
FT                   DDDWIRKEEITKVQNVLSNMNERDRTILLMKFSGFQYKEIADVLHIDISSIGTLLVRAK
FT                   QKFRKMYKQVEEA"
FT   regulatory      complement(91851..91856)
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(91855..92007)
FT                   /note="ProfileScan hit to PS50043, Helix-turn-helix domain,
FT                   luxR and related types (substantial overlap with lysR
FT                   type)."
FT   misc_feature    complement(91882..91965)
FT                   /note="ScanRegExp hit to PS00622, Bacterial regulatory
FT                   proteins, luxR family signature."
FT   regulatory      complement(92387..92391)
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   complement(92640..94600)
FT                   /note="CP repeat"
FT   CDS             complement(92986..96528)
FT                   /transl_table=11
FT                   /gene="cry4AA"
FT                   /gene_synonym="cryIVA(A)"
FT                   /gene_synonym="isrH4"
FT                   /gene_synonym="pBt110"
FT                   /product="pesticidial crystal protein cry4AA"
FT                   /note="Previously sequenced as Bacillus thuringiensis
FT                   pesticidial crystal protein cry4AA or cryIVA(A) or isrH4
FT                   SW:C4AA_BACTI (P16480) (1180 aa) fasta scores: E(): 0, 100%
FT                   id in 1180 aa"
FT                   /db_xref="GOA:Q7AL67"
FT                   /db_xref="InterPro:IPR001178"
FT                   /db_xref="InterPro:IPR005638"
FT                   /db_xref="InterPro:IPR005639"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AL67"
FT                   /protein_id="CAD30148.1"
FT                   /translation="MNPYQNKNEYETLNASQKKLNISNNYTRYPIENSPKQLLQSTNYK
FT                   DWLNMCQQNQQYGGDFETFIDSGELSAYTIVVGTVLTGFGFTTPLGLALIGFGTLIPVL
FT                   FPAQDQSNTWSDFITQTKNIIKKEIASTYISNANKILNRSFNVISTYHNHLKTWENNPN
FT                   PQNTQDVRTQIQLVHYHFQNVIPELVNSCPPNPSDCDYYNILVLSSYAQAANLHLTVLN
FT                   QAVKFEAYLKNNRQFDYLEPLPTAIDYYPVLTKAIEDYTNYCVTTYKKGLNLIKTTPDS
FT                   NLDGNINWNTYNTYRTKMTTAVLDLVALFPNYDVGKYPIGVQSELTREIYQVLNFEESP
FT                   YKYYDFQYQEDSLTRRPHLFTWLDSLNFYEKAQTTPNNFFTSHYNMFHYTLDNISQKSS
FT                   VFGNHNVTDKLKSLGLATNIYIFLLNVISLDNKYLNDYNNISKMDFFITNGTRLLEKEL
FT                   TAGSGQITYDVNKNIFGLPILKRRENQGNPTLFPTYDNYSHILSFIKSLSIPATYKTQV
FT                   YTFAWTHSSVDPKNTIYTHLTTQIPAVKANSLGTASKVVQGPGHTGGDLIDFKDHFKIT
FT                   CQHSNFQQSYFIRIRYASNGSANTRAVINLSIPGVAELGMALNPTFSGTDYTNLKYKDF
FT                   QYLEFSNEVKFAPNQNISLVFNRSDVYTNTTVLIDKIEFLPITRSIREDREKQKLETVQ
FT                   QIINTFYANPIKNTLQSELTDYDIDQAANLVECISEELYPKEKMLLLDEVKNAKQLSQS
FT                   RNVLQNGDFESATLGWTTSDNITIQEDDPIFKGHYLHMSGARDIDGTIFPTYIFQKIDE
FT                   SKLKPYTRYLVRGFVGSSKDVELVVSRYGEEIDAIMNVPADLNYLYPSTFDCEGSNRCE
FT                   TSAVPANIGNTSDMLYSCQYDTGKKHVVCQDSHQFSFTIDTGALDTNENIGVWVMFKIS
FT                   SPDGYASLDNLEVIEEGPIDGEALSRVKHMEKKWNDQMEAKRSETQQAYDVAKQAIDAL
FT                   FTNVQDEALQFDTTLAQIQYAEYLVQSIPYVYNDWLSDVPGMNYDIYVELDARVAQARY
FT                   LYDTRNIIKNGDFTQGVMGWHVTGNADVQQIDGVSVLVLSNWSAGVSQNVHLQHNHGYV
FT                   LRVIAKKEGPGNGYVTLMDCEENQEKLTFTSCEEGYITKTVDVFPDTDRVRIEIGETEG
FT                   SFYIESIELICMNE"
FT   misc_feature    complement(94495..96444)
FT                   /note="HMMPfam hit to PF00555, delta endotoxin"
FT   misc_feature    complement(96244..96309)
FT                   /note="1 probable transmembrane helix predicted for pBt110
FT                   by TMHMM2.0"
FT   regulatory      complement(96536..96540)
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   complement(97213..97229)
FT                   /rpt_type=INVERTED
FT   repeat_region   complement(97213..98073)
FT                   /note="IS240"
FT   CDS             complement(97275..97982)
FT                   /transl_table=11
FT                   /gene="pBt111"
FT                   /product="insertion sequence IS240 protein"
FT                   /note="Similar to Bacillus thuringiensis insertion element
FT                   IS240-A protein TR:Q45766 (EMBL:M23740) (235 aa) fasta
FT                   scores: E(): 4.8e-92, 100% id in 235 aa"
FT                   /db_xref="GOA:Q7AL66"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AL66"
FT                   /protein_id="CAD30149.1"
FT                   /translation="MEKENIFKWKHYQADMILWTVRWYLRYNLSFRDLVEMMEERGLSL
FT                   SHTTIMRWVHQYGPELNERIRKHLKRTNDSWRMDETYIKIKGENMYLYRAVDSEGNTLD
FT                   FYLSKKRDAKAAKCFLKKALASFHVTKPRVITVDGNKAYPVAIRELKNEKSIPYGMPLR
FT                   VKKYLNNMIEQDHRFIKKRILNMLGLKSMQTAVKMIAGIEAMHMVKKGQLKLRAQSAQN
FT                   QNRCIHQLFGLTA"
FT   misc_feature    complement(97386..97781)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   98057..98073
FT                   /rpt_type=INVERTED
FT   CDS             complement(98503..98916)
FT                   /transl_table=11
FT                   /gene="pBt112"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNS2"
FT                   /protein_id="CAD30150.1"
FT                   /translation="MRAVAKKVQMLRLQEKRNKREENTEADCTKQCKIESECIKLENNT
FT                   AKKRSQKVQASEEKWDKKCKQAVQLFNQGMEYPTIAKKVGCNVSSLYRELKKRDLLQMP
FT                   KQVASSKSVKSSIIPPQTKKSKFERYKEYYMYR"
FT   regulatory      complement(98926..98930)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(99091..99489)
FT                   /transl_table=11
FT                   /gene="pBt113"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="InterPro:IPR019718"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNS1"
FT                   /protein_id="CAD30151.1"
FT                   /translation="MGKMESIVLRKRYHIQYNKDNDYTEEIGIMNKRETRIRILDLQDQ
FT                   HCMGCKHYNGVRTYCMDDCKIGKEIYQLGTGLIFDEKDSKRKVKLKWDSICQQALVLRN
FT                   KGYTYQKIANQLGCHASSLRKQLNQRGL"
FT   regulatory      complement(99503..99507)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             99594..99776
FT                   /transl_table=11
FT                   /gene="pBt114"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNS0"
FT                   /protein_id="CAD30152.1"
FT                   /translation="MLAMCYNKKCKRVRIQKKPICIEIGSLLDDDENKIFFKSLLGVSF
FT                   KETSILVLVLHNWNL"
FT   CDS             complement(99865..100002)
FT                   /transl_table=11
FT                   /gene="pBt115"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNR9"
FT                   /protein_id="CAD30153.1"
FT                   /translation="MDASFSILNKKFKIVDSCYNGINMKIPHHICCVAGNGEGYRLHFS
FT                   "
FT   CDS             complement(100124..100531)
FT                   /transl_table=11
FT                   /gene="pBt116"
FT                   /product="hypothetical exported protein"
FT                   /note="no database matches"
FT                   /db_xref="InterPro:IPR021598"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KH08"
FT                   /protein_id="CAD30154.1"
FT                   /translation="MFTKKLVAVATTVALGSGFTFGITPAFADSNEVSTHHTPISTIQK
FT                   QEQIPFTGYVISMDSHYLVLADTSTKEEALSYQNDWWELVSQNKILRVPLSNAENYAVG
FT                   DKLHVHASAWTASLPPIAVMPTIEKAADKYQ"
FT   misc_feature    complement(100448..100531)
FT                   /note="Signal peptide predicted for pBt116 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 28 and 29"
FT   regulatory      complement(100540..100547)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(100914..101057)
FT                   /transl_table=11
FT                   /gene="pBt119"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNR8"
FT                   /protein_id="CAD30155.1"
FT                   /translation="MQLCIMFRNLNVVDNKYGRIMGVNTFYKTDSFERRNISITLEDMA
FT                   SF"
FT   repeat_region   complement(101281..101309)
FT                   /rpt_type=INVERTED
FT   repeat_region   101281..103269
FT                   /note="IS231?"
FT   CDS             complement(101356..101616)
FT                   /transl_table=11
FT                   /gene="pBt120"
FT                   /product="putative DNA binding protein"
FT                   /note="Similar to Helicobacter pylori preprotein
FT                   translocase secA subunit secA or hp0786 SW:SECA_HELPY
FT                   (O25475) (865 aa) fasta scores: E(): 3.9, 48.38% id in 31
FT                   aa. Contains HMMPfam hit to PF02810, SEC-C motif (The motif
FT                   is predicted to chelate zinc with the CXC and C[HC] pairs
FT                   that constitute the most conserved feature of the motif. It
FT                   is predicted to be a potential nucleic acid binding
FT                   domain.)"
FT                   /db_xref="GOA:Q8KNR7"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNR7"
FT                   /protein_id="CAD30156.1"
FT                   /translation="MCLLGSENNPIMIKVGTRARAEKIAAICDEYDLYYIISLELNEDL
FT                   TDLKKAMKGRTRPMDIYDTCACNSGKKYKFCCMSKEIELDI"
FT   misc_feature    complement(101374..101436)
FT                   /note="HMMPfam hit to PF02810, SEC-C motif"
FT   regulatory      complement(101625..101629)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      101671..101675
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             101683..102438
FT                   /transl_table=11
FT                   /gene="pBt121"
FT                   /product="IS231 transposase"
FT                   /note="Similar to Bacillus thuringiensis transposase IS231W
FT                   ORF 1 TR:Q45714 (EMBL:M83546) (250 aa) fasta scores: E():
FT                   6.2e-93, 99.18% id in 245 aa, and to Bacillus thuringiensis
FT                   transposase for insertion sequence element is231e
FT                   SW:T23E_BACTF (Q02403) (478 aa) fasta scores: E(): 5e-42,
FT                   49.37% id in 241 aa"
FT                   /db_xref="GOA:Q8KNR6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNR6"
FT                   /protein_id="CAD30157.1"
FT                   /translation="MKKSSHFKDFRLLVKELQRVFSSHFLTHLGKETQFVQRTSKFGAQ
FT                   DLAALCIGMGQDIASYSLTRLCGVLESETGVLISPEGLNVRLNEKAVEFLRSLFSQLLQ
FT                   KQLLATISLPSSFSEYFRRIRILDATTFQISDQLAAVYPGSGGSGKASGVKIQLEYDLL
FT                   SGQFLHVALGPAKENDVNYGKEVQPTVDLQGLCIRDLGYFSLIDLDGIQQKGAYYLSRL
FT                   KMNTKLFQKMKRPLFLKMEQVRKISIYND"
FT   misc_feature    102046..102435
FT                   /note="HMMPfam hit to PF01609, Transposase (IS4 family)"
FT   CDS             102431..103102
FT                   /transl_table=11
FT                   /gene="pBt122"
FT                   /product="IS231 transposase"
FT                   /note="Similar to Bacillus thuringiensis IS231W ORF 2
FT                   TR:Q45713 (EMBL:M83546) (250 aa) fasta scores: E():
FT                   1.7e-87, 100% id in 223 aa, and to Bacillus anthracis
FT                   pxo1-35 TR:Q9X306 (EMBL:AF065404) (478 aa) fasta scores:
FT                   E(): 1.5e-51, 58.06% id in 217 aa, and to Bacillus
FT                   thuringiensis transposase for insertion sequence element
FT                   IS231e SW:T23E_BACTF (Q02403) (478 aa) fasta scores: E():
FT                   1.7e-51, 58.52% id in 217 aa"
FT                   /db_xref="GOA:Q8KHX5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KHX5"
FT                   /protein_id="CAD30158.1"
FT                   /translation="MIDLETIMEQLQPGELYEIPVVYVGRDYLLPVRAVMYRLTPDQET
FT                   QRRKDRAYKEKKKNITFSDRTKKLQGINVYITNIPLEYVSKEAIHEFYSLRWQIEIIFK
FT                   TWKSIFRIHSNTNVKKERLECHIYGKLIALLLSSTVMFQMRQVLLIKKQKELSEWKAMY
FT                   MIHDYFRVLYRQIQEQSKQLITSFLRLFHLLDKNGRKSHRYRKKTVFDILGTAYEQYIE
FT                   K"
FT   misc_feature    102446..102838
FT                   /note="HMMPfam hit to PF01609, Transposase (IS4 family)"
FT   repeat_region   103241..103269
FT                   /rpt_type=INVERTED
FT   CDS             103270..103536
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pBt123"
FT                   /product="hypothetical membrane protein"
FT                   /note="no database matches; probably interrupted by
FT                   adjacent IS231 element"
FT   misc_feature    103339..103407
FT                   /note="probable transmembrane helix predicted for pBt123 by
FT                   TMHMM2.0"
FT   CDS             103546..103794
FT                   /transl_table=11
FT                   /gene="pBt124"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNR5"
FT                   /protein_id="CAD30160.1"
FT                   /translation="MRKFKGRRSGGILIHQYELNFSVMYSGKVTDSQSTIIPAQSLEEA
FT                   SKKLHSEVKRGLGKCSIKMNSASLFVSEEVQYTVLQK"
FT   CDS             104079..104288
FT                   /transl_table=11
FT                   /gene="pBt125"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNR4"
FT                   /protein_id="CAD30161.1"
FT                   /translation="MSRYVCLSLCDYRYVTDGEIFKVMEHEKSILDTKHKKIVLLLIEM
FT                   ARLYDEMNHSSGWKCVGMGVDFLL"
FT   regulatory      104310..104314
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             104322..104678
FT                   /transl_table=11
FT                   /gene="pBt126"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNR3"
FT                   /protein_id="CAD30162.1"
FT                   /translation="MIFLFRFDVTDKGMDFILNEEIAKDMYPDLEEMLRDLVRSLCSML
FT                   EYYKVYNKEKTIFSGFIHDNGEAEVTLSKGLGKYIDPYTKNQIIFDHGKLITELCTTIM
FT                   DRRSAEAQLKGERW"
FT   regulatory      105186..105189
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             105195..106196
FT                   /transl_table=11
FT                   /gene="pBt127"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar in parts to Bacillus anthracis gene
FT                   fragments pxo1-106 TR:Q9X375 (EMBL:AF065404) (126 aa) fasta
FT                   scores: E(): 4.9e-17, 80.76% id in 78 aa, and to Bacillus
FT                   anthracis pxo1-71 TR:Q9X341 (EMBL:AF065404) (85 aa) fasta
FT                   scores: E(): 2e-08, 36.98% id in 73 aa, and to Bacillus
FT                   anthracis pxo1-72 TR:Q9X342 (EMBL:AF065404) (101 aa) fasta
FT                   scores: E(): 3.6e-08, 38.77% id in 98 aa, and to Rickettsia
FT                   conorii hypothetical 12.1 kDa protein rc1156 TR:AAL03694
FT                   (EMBL:AE008664) (102 aa) fasta scores: E(): 2e-07, 40.96%
FT                   id in 83 aa, and to Rickettsia conorii hypothetical 8.9 kDa
FT                   protein rc1157 TR:AAL03695 (EMBL:AE008664) (78 aa) fasta
FT                   scores: E(): 0.021, 32.81% id in 64 aa"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNR2"
FT                   /protein_id="CAD30163.1"
FT                   /translation="MLIIRACLHVQFVFMYNKKKEILSDRERKPMSNQKLVNLRIDFAF
FT                   KQLFGTSGSEDILLTFLNAMLADSLESLIQSLQFEDPHLHREHEEDKLSILDVSATLDT
FT                   GTKINIEIQLNNNHDLLKRSLYYWSKLYASQLKKGMPYSSLHKTITINLLNFVMFKDYE
FT                   AFHTTGKLWNMQQQQLLSDDIEIHVVEIPKLLQQWREEKVNPWEDSFVRWLLLLPANED
FT                   EHLTHTLEAIAMNQDPILQKAIDKWEHMSQDASFRQAYEVREKILMDEAAGIAHALNKG
FT                   REEGMKKGLEQGVQQGKRQMILGMHRLQVPIETIAQASELTIEEVKKIIEQA"
FT   CDS             complement(106467..106646)
FT                   /transl_table=11
FT                   /gene="pBt128"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNR1"
FT                   /protein_id="CAD30164.1"
FT                   /translation="MEMVEVLNPLTEIQVIILTCPLNCMHKEMVADIIVSQGGIQGVSV
FT                   KHMYFHHKLRYTVK"
FT   regulatory      107071..107074
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             107086..107373
FT                   /transl_table=11
FT                   /gene="pBt129"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNR0"
FT                   /protein_id="CAD30165.1"
FT                   /translation="MKTILIRDDTLAHIKNDLVEISQSNVNSKGLTHVQITLNKNEIIH
FT                   LANKLQSMFGKVDICIHCDKVIDAFEMPYRYKSRKQAHLGCHIYNNRGRV"
FT   CDS             complement(107664..108362)
FT                   /transl_table=11
FT                   /gene="pBt130"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="Similar to Bacillus subtilis YknW protein yknW
FT                   TR:O31709 (EMBL:Z99111) (231 aa) fasta scores: E():
FT                   3.7e-15, 34.23% id in 222 aa, and to Bacillus halodurans
FT                   Bh3124 protein bh3124 TR:Q9K882 (EMBL:AP001517) (224 aa)
FT                   fasta scores: E(): 6.6e-11, 28.01% id in 207 aa"
FT                   /db_xref="GOA:Q8KH07"
FT                   /db_xref="InterPro:IPR009698"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KH07"
FT                   /protein_id="CAD30166.1"
FT                   /translation="MEANMKIQDVGVKKPSLFGMITSPGLQFERMKTSKRVWGVFFLVA
FT                   LLQGLLGGLSAYVIHTSPEMLKMKKELGELAGQSSLTSEVISGIGSSFASAMVGTLFIA
FT                   AIYKMFMMIFGNDTPYKTLVNIVVYTNIVLIIGGLINTILSLIFGTGMTQYTSLGLLFT
FT                   EGTFAYGIGNTIEVFYVWNLALIWLGLHITAGLSKVKASIPIIILFIIKAVFLAAIIVL
FT                   MAKLLPGIPM"
FT   misc_feature    complement(join(107691..107756,107793..107858,
FT                   107919..107984,108042..108107,108186..108251))
FT                   /note="5 probable transmembrane helices predicted for
FT                   pBt130 by TMHMM2.0"
FT   regulatory      complement(108370..108376)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(108471..109670)
FT                   /transl_table=11
FT                   /gene="pBt131"
FT                   /product="putative ABC-transporter permease protein"
FT                   /note="Similar to Bacillus subtilis hypothetical 42.1 kDa
FT                   protein in moad-frur intergenic region yknZ SW:YKNZ_BACSU
FT                   (O31712) (397 aa) fasta scores: E(): 2.9e-68, 52.36% id in
FT                   401 aa, and to Rhizobium loti permease protein of ABC
FT                   transporter mlr1397 TR:Q98KN3 (EMBL:AP002997) (405 aa)
FT                   fasta scores: E(): 6.4e-36, 34.15% id in 404 aa"
FT                   /db_xref="GOA:Q8KNQ9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNQ9"
FT                   /protein_id="CAD30167.1"
FT                   /translation="MSLLDSIKIALSSILAHKLRSALTMLGIIIGVGSIITVVAIGQGG
FT                   EAALKSQFVGSGNQTVPIHYSPDINDPFGMDMAEAPKITEEDIFELKKIPEIAHIVTTN
FT                   SSMESLDIEDKKEMVNITGLDNEYFTVNKVKVLKGRSLQESDVDQGNNVVMISKQMKEK
FT                   VFKDANPVGKIIEVKGQPMQIIGVYKSDNKFMGMGPSEALVPISLWPTLYGKDEIQNIS
FT                   VQAKNVDHLEQAGKKAADVLNSRKPSDATGKYEVVNLKEIQEGISKMTGIMTMIIGGIA
FT                   GISLVVGGIGVMNIMLVSVTERTREIGVRKALGATRSKILLQFLIEAVMLTLLGGLIGI
FT                   GLGYGGAYIVSTFAKWPPLVSWEVVVGGVLFSMTLGIIFGLIPANKAAKLDPIEALRYE
FT                   "
FT   misc_feature    complement(108483..109157)
FT                   /note="HMMPfam hit to PF02687, Predicted permease"
FT   misc_feature    complement(join(108528..108593,108639..108704,
FT                   108768..108833))
FT                   /note="3 probable transmembrane helices predicted for
FT                   pBt131 by TMHMM2.0"
FT   misc_feature    complement(109530..109670)
FT                   /note="Signal peptide predicted for pBt131 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.800) with cleavage site
FT                   probability 0.260 between residues 50 and 51"
FT   CDS             complement(109667..110347)
FT                   /transl_table=11
FT                   /gene="pBt132"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="Similar to Bacillus subtilis putative ABC
FT                   transporter, YvrO yvrO TR:O52857 (EMBL:AJ223978) (229 aa)
FT                   fasta scores: E(): 6.4e-48, 63.22% id in 223 aa, and to
FT                   Streptococcus pyogenes putative ABC transporter spy0837
FT                   TR:Q9A0C4 (EMBL:AE006534) (228 aa) fasta scores: E():
FT                   4.9e-44, 57.33% id in 225 aa"
FT                   /db_xref="GOA:Q8KNQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNQ8"
FT                   /protein_id="CAD30168.1"
FT                   /translation="MITLNNIAKTYYQGKLAVPILHDISLTIQSGEFVSIMGPSGSGKS
FT                   TLMNIIGCLDRPTEGEYMLNDVNILTADESKLALIRNEYIGFVFQHFNLLPRLSAVENV
FT                   ELPLVYGGVKKAERHKRALEALGKVGLADRVHHLPNELSGGQKQRVAIARAIANNPTFI
FT                   MADEPTGALDTKSGEQVMDIFTKLNAEGTTIVMVTHEEEVAAYSSRRIVLRDGKITEDR
FT                   RCAV"
FT   regulatory      complement(109678..109681)
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    complement(109697..110260)
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    complement(109700..110257)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(109709..109924)
FT                   /note="ProfileScan hit to PS50100, 2nd half motif for
FT                   nucleotide binding, associated with P-loop."
FT   misc_feature    complement(109880..109924)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   misc_feature    complement(110195..110251)
FT                   /note="ProfileScan hit to PS50101, P-loop nucleotide
FT                   binding motif (does not find all)."
FT   misc_feature    complement(110213..110236)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS             complement(110344..111537)
FT                   /transl_table=11
FT                   /gene="pBt133"
FT                   /product="putative ABC transporter exported solute-binding
FT                   protein"
FT                   /note="Similar to Bacillus subtilis YknX protein yknX
FT                   TR:O31710 (EMBL:Z99111) (377 aa) fasta scores: E(): 9e-27,
FT                   29.35% id in 385 aa, and to Bacillus subtilis YvrP protein
FT                   yvrP TR:O35007 (EMBL:Z99120) (397 aa) fasta scores: E():
FT                   3e-20, 28.75% id in 400 aa, and to Streptococcus cristatus
FT                   ATP-binding cassette transporter-like protein tptB
FT                   TR:O54498 (EMBL:U96166) (421 aa) fasta scores: E(): 0.035,
FT                   24.93% id in 397 aa"
FT                   /db_xref="GOA:Q8KNQ7"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNQ7"
FT                   /protein_id="CAD30169.1"
FT                   /translation="MVLSKITTSNNKRIWIIVGVIALIVIVAAVNIFVMQGKKKVASTS
FT                   ADAVSFEKVTERKLNNTKLISGQVKPGNIESFYADPAKGKVKDIEVKEGQEVEKGTKLF
FT                   SYDNEEINLQMKQAELDQKMADMRYDQGKKKIDSLKKEIKKAKDSGAGKEVTDPMDEQV
FT                   NELEIGQKTIDLEKEKGKLQKEELSKKQKELTIYSNFAGVVQKLDKDAAQSSSQALGGQ
FT                   GKAFLQVASKDPFQVHGTLTELQKSQIQKDQTFTVTAKANNKKKWTGKITEVSEFPTSA
FT                   EMAQAGGMGEATQNMSQYTYKASLDSQDGLSPGYHVSLQVNLENKKMIAVPSKSIVEKA
FT                   DDAFVYVEDKGKLRKQNVKKGSTDGDWTEITEGVTVGQKVVKNPSDDVYDGMEVKEK"
FT   misc_feature    complement(111436..111537)
FT                   /note="Signal peptide predicted for pBt133 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.980) with cleavage site
FT                   probability 0.371 between residues 34 and 35"
FT   regulatory      complement(111545..111551)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      111939..111942
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             111953..112174
FT                   /transl_table=11
FT                   /gene="pBt136"
FT                   /product="possible peptide antibiotic precursor?"
FT                   /note="Very weak similarity to Enterococcus faecalis
FT                   peptide antibiotic As-48 as-48 TR:Q47765 (EMBL:X79542) (105
FT                   aa) fasta scores: E(): 2, 27.14% id in 70 aa (also called
FT                   Enterococcus faecalis BacA protein bacA TR:O52963
FT                   (EMBL:D85752) (105 aa)). Similarity is after TM domain
FT                   (possible signal sequence?)"
FT                   /db_xref="GOA:Q8KNQ6"
FT                   /db_xref="InterPro:IPR020038"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNQ6"
FT                   /protein_id="CAD30170.1"
FT                   /translation="MFEIMGYFGVDRGWATKIVNAIDAVGWGVAAASAIAAIVTAGGLA
FT                   VTSAMIDVAIFTVKDFLRRNLKAQAVAW"
FT   misc_feature    112022..112090
FT                   /note="1 probable transmembrane helix predicted for pBt136
FT                   by TMHMM2.0"
FT   regulatory      112253..112257
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             112265..113932
FT                   /transl_table=11
FT                   /gene="pBt137"
FT                   /product="integral membrane protein (possible peptide
FT                   antibiotic maturation and biosynthesis protein)"
FT                   /note="Similar to Enterococcus faecalis BacB protein bacB
FT                   TR:O52964 (EMBL:D85752) (563 aa) fasta scores: E():
FT                   1.3e-06, 22.16% id in 537 aa (also called as48-B TR:O53024
FT                   (EMBL:Y12234) AS-48 maturation and biosynthesis protein)"
FT                   /db_xref="GOA:Q8KIV8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KIV8"
FT                   /protein_id="CAD30171.1"
FT                   /translation="MKGSQMIILKNIVLEQIRQDFAGVTEKVKTKLGIRLPNSLNWIIT
FT                   LLFQNTLILFFALLFEGITDPEIRNIVIVAVLLFNCFLPSSMARQNSIRVSNNPLYDLL
FT                   WQSKFNRNQLLNFTLLAEVLVFWLHELMLEIIAFYVIIRISPDWITSITFCIGWFLLVS
FT                   SIYFSKMKKLVLESWETSISVSKYTELFYVLKIGIIALIISFLTKLLFMPIIQEPITKD
FT                   VYRQGIYKLFSVFSSRVEHTFKENLGLIFNYFQFSWLYYILGGLLILYIISAIYYFYFY
FT                   SLQTHLVRHKNRVNLNQSTSRIFKFYQWLSEVLYKKHPWVKRDVIILERVIVNSNLPHR
FT                   IYLFLPPAISALIGFTILLLGSLQSYSGFILAFWFIGWMVLSQTSWLWLLNYPILHPGS
FT                   ELRQIDLVKLSSHFTVQQFLNSKGKLVNILAFPLQCFLTITLLIGFILLHGSIYELIVG
FT                   ILGMWLLFFINGGLSTYWMKLCSRFDYANMFMVRLDSYEAKFLQQFFTIPKRIINGLLF
FT                   ITFFIGAFISVELSQQLIYDIFLIIVVLWGFSLYFVKK"
FT   misc_feature    join(112379..112447,112475..112543,112604..112663,
FT                   112706..112765,112832..112900,113036..113104,
FT                   113285..113353,113366..113434,113537..113605,
FT                   113615..113683,113795..113854,113864..113923)
FT                   /note="12 probable transmembrane helices predicted for
FT                   pBt137 by TMHMM2.0"
FT   regulatory      113942..113945
FT                   /regulatory_class="ribosome_binding_site"
FT   misc_feature    113958..114083
FT                   /note="Signal peptide predicted for pBt138 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.838) with cleavage site
FT                   probability 0.614 between residues 42 and 43"
FT   CDS             113958..114491
FT                   /transl_table=11
FT                   /gene="pBt138"
FT                   /product="integral membrane protein (possible accessory
FT                   factor in peptide antibiotic secretion)"
FT                   /note="Similar to Staphylococcus aureus subspaureus N315.
FT                   hypothetical protein Sa0196 TR:Q99X19 (EMBL:AP003129) (147
FT                   aa) fasta scores: E(): 1.2e-05, 26.56% id in 128 aa, and to
FT                   Enterococcus faecalis As-48C protein as-48C (putative
FT                   accessory factor in AS-48 secretion) TR:O53025
FT                   (EMBL:Y12234) (178 aa) fasta scores: E(): 0.002, 23.56% id
FT                   in 157 aa"
FT                   /db_xref="GOA:Q8KIV7"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KIV7"
FT                   /protein_id="CAD30172.1"
FT                   /translation="MKKVIAHISLKYIWSNYSRKFTLIFLILMASCIWGGIYQSHQAPL
FT                   PPNPPDYNWMHYFSHNMEQSLFSIAVGFITYGIGSFILLFMNGMVIGIVLAMTIQHDMV
FT                   DTIFTAFLPHAIFELPAMMIAALVPFIIWNFIKKSIRLRKIQYTLIKAEVIPSVVLIVI
FT                   LLFIASIMESMFAI"
FT   misc_feature    join(114114..114182,114186..114254,114297..114365,
FT                   114402..114470)
FT                   /note="4 probable transmembrane helices predicted for
FT                   pBt138 by TMHMM2.0"
FT   regulatory      114470..114473
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             114481..115149
FT                   /transl_table=11
FT                   /gene="pBt139"
FT                   /product="putative ABC-transoprted ATP-binding protein"
FT                   /note="Similar to Thermotoga maritima ABC transporter,
FT                   ATP-binding protein tm0793 TR:Q9WZQ0 (EMBL:AE001747) (260
FT                   aa) fasta scores: E(): 1.2e-13, 32.64% id in 193 aa, and to
FT                   Streptococcus pyogenes putative ABC transporter spy1674
FT                   TR:Q99YJ5 (EMBL:AE006597) (244 aa) fasta scores: E():
FT                   5.4e-13, 28.77% id in 212 aa"
FT                   /db_xref="GOA:Q8KNQ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNQ5"
FT                   /protein_id="CAD30173.1"
FT                   /translation="MPFKKGVFMMLEIKNLKFQYEENIPLLHNISFSANPGDIIWLQGS
FT                   NGCGKSTLLRIISQLIEVDYEFYYNQQKIESKEDILTNLIYIPSEPYLFDYLTGEENAE
FT                   FLRTLFDISKNEFQQFFSKMTEEFQIKHALQKFVQEYSLGMRHKLYWSAVFARNAPIIL
FT                   LDEPFSSLDNNSQEIAIRILKQKATEGAIIIFVSHLPEISEKLATRGLTLEGGTIINRF
FT                   "
FT   misc_feature    114586..115131
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    114589..115128
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    114595..114672
FT                   /note="ProfileScan hit to PS50101, P-loop nucleotide
FT                   binding motif (does not find all)."
FT   misc_feature    114610..114633
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    114901..115074
FT                   /note="ProfileScan hit to PS50100, 2nd half motif for
FT                   nucleotide binding, associated with P-loop."
FT   regulatory      115166..115170
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             115181..115462
FT                   /transl_table=11
FT                   /gene="pBt140"
FT                   /product="integral memebrane protein"
FT                   /db_xref="GOA:Q8KNQ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNQ4"
FT                   /protein_id="CAD30174.1"
FT                   /translation="MNYLSQLIGILLGLIMYLCIIISMKIGDNTYIGDYFFKLFNMNNN
FT                   KFIVAITFFVCLWIVGKIFKDKQAIWLNWGRLLLTGLMLVALVSYLVM"
FT   misc_feature    join(115199..115252,115295..115363,115388..115456)
FT                   /note="3 probable transmembrane helices predicted for
FT                   pBt140 by TMHMM2.0"
FT   CDS             complement(115709..116362)
FT                   /transl_table=11
FT                   /gene="pBt142"
FT                   /product="putative DNA recombinase"
FT                   /note="Similar to Enterococcus faecalis recombinase ep0007
FT                   TR:Q9F1I8 (EMBL:AE002565) (213 aa) fasta scores: E():
FT                   8.2e-17, 37.01% id in 208 aa, and to Streptococcus
FT                   thermophilus putative Resolvase res TR:Q9X9M6
FT                   (EMBL:AJ242479) (198 aa) fasta scores: E(): 2.5e-13, 31.7%
FT                   id in 205 aa, and to Staphylococcus aureus potential
FT                   DNA-invertase Bin3 bin3 SW:BIN3_STAAU (P20384) (202 aa)
FT                   fasta scores: E(): 1.2e-12, 32.51% id in 203 aa"
FT                   /db_xref="GOA:Q8KNQ3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNQ3"
FT                   /protein_id="CAD30175.1"
FT                   /translation="MTNIYGYIRVSTKDQNEQRQLHKMMERGVEARRIFVDKASGRHFD
FT                   RPQYQLLRKILGTGDIVYIDALDRMGRNYDEVISEWKYITRELQADIVVLENETLFDSR
FT                   KFREMGDMGRLMEDQFLSLLSYVADQERKKIHQRQAEGIAVAKSQGKHLGRPQLTLATL
FT                   SSKQLQIIEETYPKWKNREITGIKFMELIELKKNTFYKIIKEFEVKKGKMIYKE"
FT   misc_feature    complement(115907..116017)
FT                   /note="HMMPfam hit to PF00239, Resolvase, N terminal
FT                   domain"
FT   misc_feature    complement(116129..116359)
FT                   /note="HMMPfam hit to PF00239, Resolvase, N terminal
FT                   domain"
FT   misc_feature    complement(116318..116344)
FT                   /note="ScanRegExp hit to PS00397, Site-specific
FT                   recombinases active site."
FT   regulatory      complement(116375..116378)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(116478..116627)
FT                   /transl_table=11
FT                   /gene="pBt143"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNQ2"
FT                   /protein_id="CAD30176.1"
FT                   /translation="MYKDCKLVKYSPSKLPSPKKENSHATIEKVNICLKRYTFTNIEVS
FT                   SIKH"
FT   misc_feature    116964..117044
FT                   /note="Signal peptide predicted for pBt145 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.593 between residues 27 and 28"
FT   CDS             116964..117557
FT                   /transl_table=11
FT                   /gene="pBt145"
FT                   /product="putative spore coat-associated protein"
FT                   /note="Similar to Bacillus subtilis spore coat-associated
FT                   protein N cotN SW:COTN_BACSU (P54507) (261 aa) fasta
FT                   scores: E(): 9.8e-14, 35.44% id in 237 aa"
FT                   /db_xref="GOA:Q8KNQ1"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022121"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNQ1"
FT                   /protein_id="CAD30177.1"
FT                   /translation="MSLKKKLGAGVVSAALGLSLIGGGTYAYFSDQEVTNNKFAAGTLD
FT                   FAMQPTTSLNLDNLKPGDKILKKFNIKNSGTLDIKDIVMKVDYTVNDFKKDNGVEDFGK
FT                   HIKVQFLWDWDPEKSPVYETTLAELKSQHPEVASQKIFLSKWAETGGLKSGKTDWFWMK
FT                   FTFEDNGTDQNMFQGDSIAMNMEFQANQTEGQER"
FT   misc_feature    117411..117434
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS             complement(117688..117879)
FT                   /transl_table=11
FT                   /gene="pBt146"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="InterPro:IPR011015"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNQ0"
FT                   /protein_id="CAD30178.1"
FT                   /translation="MYPKFFDKMAFSKEHKDLLIQLYNKEITRNEYNRVLNNLYETKPK
FT                   VNENKKQDKVLGSVTKFF"
FT   regulatory      complement(117891..117894)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(118131..118364)
FT                   /transl_table=11
FT                   /gene="pBt147"
FT                   /product="HfQ protein (RNA-binding protein)"
FT                   /note="Similar to Bacillus subtilis HfQ protein hfQ
FT                   SW:HFQ_BACSU (O31796) (73 aa) fasta scores: E(): 3.3e-07,
FT                   45.45% id in 55 aa, and to Bacillus anthracis pxo1-137
FT                   TR:Q9X393 (EMBL:AF065404) (61 aa) fasta scores: E(): 2e-06,
FT                   38.98% id in 59 aa"
FT                   /db_xref="GOA:Q8KNP9"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNP9"
FT                   /protein_id="CAD30179.1"
FT                   /translation="METKLQSFQKDRGKNILFSQEHLLQEAFQKKKDITLILLKGLHIK
FT                   GIITGYDTFSILIEYEGKQQLVYKHAISTIRF"
FT   regulatory      complement(118373..118378)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(118386..118673)
FT                   /transl_table=11
FT                   /gene="pBt148"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Bacillus subtilis transcription state
FT                   regulatory protein abrb abrb or cpsX SW:ABRB_BACSU (P08874)
FT                   (96 aa) fasta scores: E(): 2.8e-17, 55.05% id in 89 aa, and
FT                   to Bacillus subtilis putative transition state regulator
FT                   AbH abH SW:ABH_BACSU (P39758) (92 aa) fasta scores: E():
FT                   2.1e-16, 55.17% id in 87 aa"
FT                   /db_xref="GOA:Q8KNP8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNP8"
FT                   /protein_id="CAD30180.1"
FT                   /translation="MLMKATGIVRKVDNLGRIVIPKETRKTLQVETSDTLEFFVEEDAI
FT                   VLQKYTPHGTCPITGEISSTNVKLVGGKLTLSPEGLKQLLAELEQYKVTV"
FT   regulatory      complement(118676..118682)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(118792..119097)
FT                   /transl_table=11
FT                   /gene="pBt149"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="Similar to Bacillus anthracis transcriptional
FT                   repressor pagr pagr or tcra or pxo1-109 TR:O31178
FT                   (EMBL:AF031382) (99 aa) fasta scores: E(): 4.9e-08, 39.13%
FT                   id in 92 aa, and to Streptomyces verticillus
FT                   metal-dependent regulatory protein TR:Q9FB31
FT                   (EMBL:AF210249) (113 aa) fasta scores: E(): 5.7e-06, 36.47%
FT                   id in 85 aa, and to Xylella fastidiosa transcriptional
FT                   regulator xf0767 TR:Q9PFB1 (EMBL:AE003917) (114 aa) fasta
FT                   scores: E(): 0.00028, 32.58% id in 89 aa"
FT                   /db_xref="GOA:Q8KNP7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNP7"
FT                   /protein_id="CAD30181.1"
FT                   /translation="MPKAFYMDIEYYERPADILRMLGHPMRLMIVRELIAKGPLHVSEL
FT                   QKLLRVPQSTMSQQLIKLKQFKIVSYERKGNEVYYIVSDEKVIESMKRIEGLQQWT"
FT   misc_feature    complement(118807..119043)
FT                   /note="HMMPfam hit to PF01022, Bacterial regulatory
FT                   protein, arsR family"
FT   misc_feature    complement(118810..119049)
FT                   /note="HMMSmart hit to SM00418, helix_turn_helix, Arsenical
FT                   Resistance Operon Repressor, DNA-binding"
FT   misc_feature    complement(118852..118899)
FT                   /note="FPrintScan hit to PR00778, Bacterial regulatory
FT                   protein ArsR family signature"
FT   misc_feature    complement(118897..118944)
FT                   /note="FPrintScan hit to PR00778, Bacterial regulatory
FT                   protein ArsR family signature"
FT   misc_feature    complement(118996..119043)
FT                   /note="FPrintScan hit to PR00778, Bacterial regulatory
FT                   protein ArsR family signature"
FT   regulatory      complement(119108..119111)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(119357..119794)
FT                   /transl_table=11
FT                   /gene="pBt150"
FT                   /product="hypothetical protein"
FT                   /note="no database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNP6"
FT                   /protein_id="CAD30182.1"
FT                   /translation="MVFTDLERSLQQGVLTDIRGIVRTLLQDMDYVVEEDKSFITDAFV
FT                   KQVIVYLEKTRFFQKWIEVNFSTVELTELLQQMEHSMRRRKSTLRQRNYFNSLLYDLSL
FT                   REDIPKDYLCMKKRLLQLEHLKEQQKKEKLQNSVSTKQIKV"
FT   regulatory      complement(119806..119810)
FT                   /regulatory_class="ribosome_binding_site"
FT   repeat_region   complement(120029..120045)
FT                   /rpt_type=INVERTED
FT   repeat_region   120029..120889
FT                   /note="IS240"
FT   CDS             120120..120827
FT                   /transl_table=11
FT                   /gene="pBt151"
FT                   /product="insertion sequence IS240 protein"
FT                   /note="Similar to Bacillus thuringiensis insertion element
FT                   is240-a protein TR:Q45766 (EMBL:M23740) (235 aa) fasta
FT                   scores: E(): 4.9e-91, 99.57% id in 235 aa"
FT                   /db_xref="GOA:Q8KNP5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNP5"
FT                   /protein_id="CAD30183.1"
FT                   /translation="MEKENIFKWKHYQADMILWTVRWYLRYNLSFRDLVEMMEERGLSL
FT                   SHTTIMRWVHQYGPELNERIRKHLKRTNDSWRMDETYIKIKGENMYLYRAVDSEGNTLD
FT                   FYLSKKRDAKAAKCFLKKALASFHVTKPRVITVDGNKAYPVAIRELKNEKSIPYGMPLR
FT                   VKKYLNNMIEQDHRFIKKRIRNMLGLKSMQTAVKMIAGIEAMHMVKKGQLKLRAQSAQN
FT                   QNRCIHQLFGLTA"
FT   misc_feature    120321..120716
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   120873..120889
FT                   /rpt_type=INVERTED
FT   CDS             complement(120897..122312)
FT                   /transl_table=11
FT                   /gene="pBt152"
FT                   /product="hemagglutinin-related protein"
FT                   /note="Similar to Clostridium botulinum hemagglutinin Ha-33
FT                   protein ha-33 TR:Q45868 (EMBL:X79103) (292 aa) fasta
FT                   scores: E(): 9.6e-07, 32.35% id in 136 aa, and to
FT                   Clostridium botulinum Ha-33 protein ha-33 TR:Q45871
FT                   (EMBL:X79104) (293 aa) fasta scores: E(): 3.1e-06, 25.54%
FT                   id in 231 aa"
FT                   /db_xref="GOA:Q8KNP4"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNP4"
FT                   /protein_id="CAD30184.1"
FT                   /translation="MWRKQQKNLNFAAPLGLIQSLVITSDPQYPWTDCQDSISFPNCNN
FT                   PIVSPCSNRPENESTKEQRSAALIREQYNNINSYTDTVPNASVLINGDLTAFGHGWQWD
FT                   KINELLRILKRPYYYGLGNHDIENNFNDCVNNGCFKNSMENLIAHVQTRGIPSTQFDYR
FT                   TQPGEPYLGIPVTKHQGSFAYAVNFGSICSIQLQNFPTMNKQTGPTITDFNEYHIFENF
FT                   DWVRTQLETARINGKTIIINVHKHQMLYDQYKNLFQQYGVAAIFAGHLHTNFGYQISYN
FT                   NIPIFLSGGASQRTYLIIEQFSNRLDMYAVNCNDWRNRCLMSPIFNGEYQIVTALNNSS
FT                   VVSLEGASNTNVILMSNNKADTQKWYLSYNSVKNGYVIRRNRASNIVLAWNAAGGTANV
FT                   FTTQLIETYDAHYWAIERVNNSNEYIFKNKMNPDLVLEVAGSQTTNGTNIQVHARHPLN
FT                   TSLRNQTFLIQPI"
FT   misc_feature    complement(120906..121043)
FT                   /note="HMMPfam hit to PF00652, QXW lectin repeat"
FT   misc_feature    complement(120906..121244)
FT                   /note="ProfileScan hit to PS50231, Lectin domain of ricin B
FT                   chain profile."
FT   misc_feature    complement(120906..121328)
FT                   /note="HMMSmart hit to SM00458, Ricin-type beta-trefoil"
FT   misc_feature    complement(121203..121325)
FT                   /note="HMMPfam hit to PF00652, QXW lectin repeat"
FT   misc_feature    complement(121485..122258)
FT                   /note="ProfileScan hit to PS50185, Metallo-phosphoesterase
FT                   motif."
FT   repeat_region   complement(123298..123314)
FT                   /rpt_type=INVERTED
FT   repeat_region   complement(123298..124158)
FT                   /note="IS240"
FT   CDS             complement(123360..124067)
FT                   /transl_table=11
FT                   /gene="pBt154"
FT                   /product="insertion sequence IS240 protein"
FT                   /note="Similar to Bacillus thuringiensis insertion element
FT                   is240-a protein TR:Q45766 (EMBL:M23740) (235 aa) fasta
FT                   scores: E(): 3.5e-91, 99.14% id in 235 aa"
FT                   /db_xref="GOA:Q8KH55"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KH55"
FT                   /protein_id="CAD30185.1"
FT                   /translation="MEKENIFKWKHYQADMILWTVRWYLRYNLSFRDLVEMMEERGLSL
FT                   SHTTIMRWVHQYGPELNERIRKHLKRTNDSWRVDETYIKIKGENMYLYRAVDSEGNTLD
FT                   FYLSKKRDAKAAKCFLKKALASFHVTKPRVITVDGNKAYPVAIRELKNEKSIPYGMPLR
FT                   VKKYLNNMIEQDHRFIKKRIRNMLGLKSMQTAVKMIAGIEAMHMVKKGQLKLRAQSAQN
FT                   QNRCIHQLFGLTA"
FT   misc_feature    complement(123471..123866)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   124142..124158
FT                   /rpt_type=INVERTED
FT   CDS             complement(124656..126110)
FT                   /transl_table=11
FT                   /gene="pBt156"
FT                   /product="ftsZ/tubulin-related protein"
FT                   /note="Weakly similar to Pyrococcus kodakaraensis TubA
FT                   protein tubA TR:Q9HHD0 (EMBL:AB031743) blast scores: E():
FT                   4e-06, score: 54 21% id, and to Pyrococcus horikoshii cell
FT                   division protein ftsz homolog 3 ftsz3 or ph1335
FT                   SW:FTZ3_PYRHO (O59060) blast scores: E(): 5e-05, score: 50
FT                   23% id, and to Bacillus anthracis pxo1-45 TR:Q9X315
FT                   (EMBL:AF065404) blast scores: E(): 3e-04, score: 48 21% id"
FT                   /db_xref="GOA:Q8KNP3"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="PDB:2XKA"
FT                   /db_xref="PDB:2XKB"
FT                   /db_xref="PDB:3J4S"
FT                   /db_xref="PDB:3J4T"
FT                   /db_xref="PDB:3M89"
FT                   /db_xref="PDB:3M8K"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNP3"
FT                   /protein_id="CAD30186.1"
FT                   /translation="MLLNSNELEHIHSTNHSVNDISIRWGVIGAGQKGNKEADLFAGYK
FT                   FSNGTTCYPTLAVNFAESDMMHLQNIIKEDRIHFDGLKGAARTPSVVTDLFDPETNPNA
FT                   NGYLDKLAQELGRKFTNEEGEVIVDQFLICLGAGGGVGTGWGSLVLQLIREQFFPCPVS
FT                   MLISLPSGDPDEINNALVLLSEIDEFMREQDRLFGNSDIKPLANVIVNDNTQMQRIIES
FT                   QKGTKDLKNRYVNWKEVANDNVVSTLHEINIIPENYGSDNVTYDPSDLIKLLSIPGRFL
FT                   TIGKARIAKFDLHSLENSIKRSLDEGFFSAEHQFETATMYGGFVLRPSNADFFKDVNTE
FT                   NRIRNTLGEYKRLDEIAGKFGDPIWDNEYAVCYTIFAGMTMPKRYISLAREGKELAEKQ
FT                   EQLRAEAQRKQDEEKVDISFATNRVQKNTFNPYNKNQGFGGASRFSGGKNSAFKRQTSE
FT                   ATSTQNQQEEENIISTLKTSNPFKKR"
FT   regulatory      complement(126119..126123)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(126131..126445)
FT                   /transl_table=11
FT                   /gene="pBt157"
FT                   /product="putative DNA-binding protein"
FT                   /note="Contains predicted helix-turn-helix motif Score 1099
FT                   (+2.93 SD) at aa 41-62"
FT                   /db_xref="GOA:Q8KNP2"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="PDB:3M8E"
FT                   /db_xref="PDB:3M8F"
FT                   /db_xref="PDB:3M9A"
FT                   /db_xref="PDB:4ASO"
FT                   /db_xref="PDB:4ASS"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNP2"
FT                   /protein_id="CAD30187.1"
FT                   /translation="MNRDHFYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTA
FT                   VAEMIQLSKPTVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKAMEMRNL
FT                   "
FT   regulatory      complement(126453..126456)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(126827..127372)
FT                   /transl_table=11
FT                   /gene="pBt158"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Clostridium acetobutylicum
FT                   transcriptional regulator, merr family cap0178 TR:AAK76923
FT                   (EMBL:AE001438) blast scores: E(): 5e-05, score: 48 30% id"
FT                   /db_xref="GOA:Q8KNP1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KNP1"
FT                   /protein_id="CAD30188.1"
FT                   /translation="MSESKTNEEQNEYKMKEVSELTGLSNDLLRVYEEEFNLQINRTNG
FT                   GHRRYTEDDINKFISIKKKIQEQNWSYKKVRSWLNGDELPVALEEHQVKTNLEKKVEYQ
FT                   TELIQDLTEKLDQSIKLQVEMVKQMHELKTEKQELEQIVARRNQDLIDTLIQEKRKERQ
FT                   ERIVTESKKSFLQKIFGK"
FT   misc_feature    complement(127127..127336)
FT                   /note="HMMSmart hit to SM00422, helix_turn_helix, mercury
FT                   resistance"
FT   regulatory      complement(127382..127389)
FT                   /regulatory_class="ribosome_binding_site"
XX
SQ   Sequence 127923 BP; 42506 A; 20860 C; 20607 G; 43950 T; 0 other;
     taaatatgaa ctgtataata agaaccaagt gacctaaaca atatgctatt aagctacaaa        60
     caactcttgt atttgcactt aaatgaacac ctattttctt actaagtttt taagtctaca       120
     taaatatttt tatttaaaat tagaatgcgc atatcgttat aaaagccttt taaataaagg       180
     gttttattaa agttcgaatt aacttattct agatttaaat ctaacttgtt ttaattcgtg       240
     tttatatctc gttttaactt ttattccagt aatgtttttt gttttgattt aaaagtcata       300
     ttcatcgtgc aaaaaaagag aaaatcagtt taatgcggta tatatttatg gattcttgaa       360
     tttataaaat tagaattaat atgttctagt attgtttcta tgtttttgtt gatcgttttg       420
     ttatatcatt tctatgtttt tttctttgtt tgatatgcta atttatgtta aattagaatt       480
     gtaattattg ctcataatca ttgttataaa agggttttta ttaatatttt aatacacttt       540
     atctagtttt aaaaccattt tataataatt tttatgttct acatatagtt cgatatattg       600
     aaaggtttgt ctataaatga gattaaaaaa ctagaaagct ttttttcgaa aatagaacta       660
     tagaataact gtattaaact ttaaattgtt atataaaaaa atacgatttt ataaaaaatc       720
     gtcttgcaag taccaaaaaa tgcatatatg attacattaa aatgcgccaa atcttagcta       780
     tagttatagt tttgccgcaa ttgactaaaa ataaacataa aaaagcaaaa aaaagatctt       840
     tcagcttgat gaaatagcgt caactatttc atcgaggtta atctctagga acccacgaaa       900
     ctcttattga ttgaaagtta aacttacaat gttacctaga ttaaacttta gcttcaaaac       960
     cttttttgat ttgtataaat ttataagata attttacttg atcttataaa tttgtgcaac      1020
     tgaaaaaggc gattttcttg cgtattttga gcattgttta tctagaaata tacaaaaatc      1080
     atctagattt gagaagattt ttgtatatgt gatattacag tgtctttttt tgtgctcttt      1140
     tcggaaggat tcattttaaa caatgagtac acatttaaat ttttctcagc agaattttaa      1200
     agtccatgga gttaagtttt ttgatggact ttttaatatt ataaaactcg aaaatgaacg      1260
     caaagaatta ccatcctcag cattagcgac ttatatcatg cttcactttg aatgcaatga      1320
     tataggaatg ctaccacgtg aatttcaaat aatggatctt gctaaaaaaa gtgggattcc      1380
     ctacacaaca atttatacag gatttcaagt ttgcttggag cgtaagctcg taagagaaat      1440
     acctgttgga aatcgtactg tttatgaaat tgtagattat gcattataca accacactgc      1500
     tgcagaaact acagatatga taaatatatc gttatcgtat ttccgtattc cattttattt      1560
     aattcaaaca actatactaa gtagccttgt aaaggctcga gataatagag gaattatgat      1620
     tcttttagaa ttaatcaaca cattttcgag aaaaattggt atggaacatt ataagcacaa      1680
     gattgaagat ttcgagatta cgagaaaaat ggcttttcta aaggaaaagt tgaatcgtaa      1740
     tgcaaagaaa gtgcgacaat acatagagat tgtaaagcct attaaattta atgcagtaga      1800
     tcttaaagat aagaaatcaa gtgagtctcg tattacacgt gttagaaggc aggtacaaca      1860
     agttattatt gaaaagttta atgtcatttt ttcttcgaat tgtgttattg aaaatgataa      1920
     aaaagaatta catagaccta tagcgaagtg tagaaaagaa gcagtatctc gtttgaaaca      1980
     tatgggacaa gcgttaagaa aaaaagataa agaaaatata atgactgcat ttagacaaga      2040
     aattgttgat atcgaaatct atttaccaac aaaacaaaaa caaaattaat tattaatata      2100
     tgcaatgact catgcattag atcaagttga aagttgtaca aaagatcaag aaatattctc      2160
     tatcccagca tttatgcgag ttcagtttag agaagcctgg acacattttg ctgagaaaag      2220
     tttgtcagaa gaagaaagta tcgagggttc tggtgcaaaa aagctaaatg atttgaaaat      2280
     attctttcaa acttggccat actggtatta ctacttaaaa aaggtgcgtg atcaggatgg      2340
     aaaaagaaaa catattcaaa tggaaacatt atcaagcaga catgattttg tggactgtac      2400
     gctggtacct gcggtataac ctaagctttc gtgatttggt ggaaatgatg gaagaacgag      2460
     ggttatcttt gtcccatacc accattatgc gttgggttca ccaatatgga cccgaattaa      2520
     atgagcggat tcgaaaacat ttgaaacgaa cgaatgattc ttggagagtg gatgaaacct      2580
     atatcaaaat caaaggtgaa aacatgtact tataccgtgc tgttgattcc gaaggaaaca      2640
     cgcttgattt ttatttgagt aagaaacgag atgcgaaggc tgccaagtgc tttttaaaga      2700
     aagccttggc ttcttttcat gtcacaaaac ctcgtgtaat cactgttgat ggtaataaag      2760
     cctatcccgt tgcgatacga gaattaaaaa atgaaaaaag cataccatat ggtatgccac      2820
     ttcgggttaa aaaatattta aacaacatga ttgaacaaga ccatcgattt ataaaaaaac      2880
     gaattctgaa tatgcttggt ttgaaatcga tgcaaacagc tgtaaaaatg attgctggaa      2940
     tagaagccat gcatatggtc aaaaaaggtc aactcaaatt aagggcacaa tctgcccaaa      3000
     atcagaatag atgtattcat cagttatttg gattaactgc ttaggagtgg attccagaag      3060
     gaatctatgc ctttttttgc gtttgtccat tatttgcacc agaacctttg atatagatgt      3120
     tttttgtgtt ttatatacag ctaatttacc tttatattca ctaatatcac ttattaaatt      3180
     tattaattct cttttaaaat taatattcat atacgtctct tcaaaaaaat tccgcatcta      3240
     ttttcctcca ctgcctctgc tatattcctt ataagaaaag ttattttaat aatatattac      3300
     tatgaaaata gctctttttg taattctatt ttttggaatg aaaaaagggc tgcaaattta      3360
     atacaagtgt gcagatttaa aaagcaattt tacactacaa aatagctaat aatagttgaa      3420
     ttttttgttg gatattcgta tataatttca tattttcagt gaagtattct ctccaaacac      3480
     cactctattt ataatagatg tcttgctatt tataaatttc ggttctggtg caaaaaagct      3540
     aaatgatttg aaaatattct ttcaaacttg gccatactgg tattactact taaaaaaggt      3600
     gcgtgatcag gatggaaaaa gaaaacatat tcaaatggaa acattatcaa gcagacatga      3660
     ttttgtggac tgtacgctgg tacctgcggt acaacctaag ctttcgtgat ttggtggaaa      3720
     tgatggaaga acgagggtta tctttgtccc ataccaccat tatgcgttgg gttcaccaat      3780
     atggacccga attaaatgag cggattcgaa aacatttgaa acgaacgaat gattcttgga      3840
     gagtggatga aacctatatc aaaatcaaag gtgaaaacat gtacttatac cgtgctgttg      3900
     attccgaagg aaacacgctt gatttttatt tgagtaagaa acgagatgcg aaggctgcca      3960
     agtgcttttt aaagaaagcc ttggcttctt ttcatgtcac aaaacctcgt gtaatcactg      4020
     ttgatggtaa taaagcctat cccgttgcga tacgagaatt aaaaaatgaa aaaagcatac      4080
     catatggtat gccacttcgg gttaaaaaat atttaaacaa catgattgaa caagaccatc      4140
     gatttataaa aaaacgaatt cggaatatgc ttggtttgaa atcgatgcaa acagctgtaa      4200
     aaatgattgc tggaatagaa gccatgcata tggtcaaaaa aggtcaactc aaattaaggg      4260
     cacaatctgc ccaaaatcag aatagatgta ttcatcagtt atttggatta actgcttagg      4320
     agtggattcc agaaggaatc tatgcctttt tttgcgtttg tccattattt gcaccagaac      4380
     cgccaatatg cttctcatga atatcaaaaa atcttaaaaa aggaaaaatt ccaagtaagt      4440
     atgagccgta aaggaaattg ttatgataac gcagtgattg aatcttttca tagtgtataa      4500
     aaaaaagaat gggtctatcc gaaaaaatat agaacgcgag acgaagcgaa atccagtatt      4560
     tttaaatata ttgaagtgtt ttacaatcga aaacgtagcc attctgcact gaagtatgta      4620
     tcaccgattc aatttaaaaa gaggttctat gaaaagcaac aatctcaagc tgcttaacga      4680
     ataaaatgtc tctgtttaat gtgtctattt tcttgacata acaccagata tttctagcaa      4740
     agtttatatg gctcatatta agcgatacaa gctcttgcaa agacaaccca tagtttacta      4800
     ctaaatttat aatacaaacg tttctatcca taataagagg gcgatattta gcttgtcttt      4860
     ccgttagccc ttttgttgat aggacagttt gttttaaaag cttttcttcc atttcggtaa      4920
     taaaatcatt atcatttagt gattgatcag gaatcaaaga gagattaata ccatccaatg      4980
     gactaactat gcataaaaac atgtgtaact tctttaaaac cacccatatt ctgtgtcttg      5040
     ttttctgaga atatttacgc ttgtcttcta actcagagaa atacgtctga taatccgctt      5100
     cagaaagttc actccatgat ttgatatgta gaagtttttt atttgctctt aaccacttat      5160
     aaaaatcttt aatatcgtaa gcataacgtt taatcgtgga ttgtttccgt cctttttcta      5220
     ttaaataagc agaaaaggct gctaatgttt cttctaaatt aatgtttttg ctcattataa      5280
     tcacctaatt tcttaggata tattataaca gaaaataagt gaaagacctg ctaccgccct      5340
     ttgctttttt gatatgttga ttattattta caaagccaaa tgaatgtggc tatcataata      5400
     ctccaaaagg gaactacaaa gattagtccc caaaatatcc ctttgaaaaa tccaatctcg      5460
     ttataagtat tcatttctat gtaattcgaa tcttttagta cagccatgtt taatcctccc      5520
     aatatgaatt gtttattaaa ataaaaaagg acaaacctcg ccctggtagg gatacgtagg      5580
     tttgtccttt tttatgtggg taatgatatg tttaattacc attattataa cggaatttac      5640
     atatattttc aattaggtcg gacattttat taacaagcat actagctgta ttaaaaatct      5700
     attataaata tatatcttat atattaaaaa aaaaataaag ataaaactat tataggttat      5760
     caaaaatagg ggaaagacct actcccacaa gggaaaattt gatgttagaa cgtaaaaaat      5820
     cataaatagt agaaaatgta tacggaaatt caatgattat tagactatca attctacaaa      5880
     aaagcagaaa gagaattata tgtttctaca tgaaatcgga aagaaattga tacaaatcac      5940
     tttatattta tccaactata gaaataggct ttattttctt tattttgtta aatacagcaa      6000
     tatctaacgt acaattatcc acattttatc cagattagac tactatttgt taacattaat      6060
     cagtgtttat acataactca catttttatt gatgattttt attagataaa tacaacaaca      6120
     ttagtaatta caatgttttt agaaatatta tattcacatc gaatcatata tgtccgcata      6180
     tccactattt ttataatttt ccttatgatt ttttgtaggt attataagat aggttttaat      6240
     agattagaag aatactccct gacgttatgt ggagagttat atattgctag aattgaattt      6300
     gtatagaatt gcataaaaaa agactccatt ttacatgaag tccttctgat ttggtatgta      6360
     taaatagagt agtagaaaag gggtgttaat gaaacaaaca cgaatagccc tccactttcg      6420
     attttttcaa aaatagagag ctcattacta ttattttatt tccattgcgt gtagcacctg      6480
     atctggagct gttattgtta ctccagcacg tactaaacgt tcgaaggtac gcataaactc      6540
     tagtaaatta aactgctttg gtagttcaat aacacgaagt ttttcttgtg gcagcttatc      6600
     aattgcctcg ataaaccatt cacgaacatc acttggaatc gtgcgttctt tatgaccacg      6660
     aacttttagt ttttcacgca tttcaatttc taaagcgata tatgcatgga gattaacacc      6720
     ctgatcatat gcatattttc taaataacgt ttcttcctgg tattttagat aattacggta      6780
     ataagactct tccgtcactg gtactgcaaa tttctgcttc agtagtgcat gcacattctt      6840
     aaacattctc ttaatgttat gaagagagta catagaataa tgtagaccaa aattaaagac      6900
     agcttgctca cggtcactat ttctctcttt tggtatatgc tgcgcaataa gaggatagat      6960
     accttctttt gctgctgtat cgagaatttg atattgagat gtttgatgca atagtttctt      7020
     caatgtatat acaattttcg ttggatatcc ttcttttcga tcaaccatgt cacgtagtcc      7080
     gcgaattaca ctgcgaattt gacgatgaca agtatacttt aatacatgaa tgaatttatt      7140
     catgtctgca gacagttcac cgatattcat ttcttgtaag actgcttcga taaattttgc      7200
     ttttctagca taggtagctt ttggtgtaaa tggatcccta tgttgttctt ctccagcttc      7260
     tttcgaacat aagaagtctg aatggataga cagatataac gtcgtatatc gttttgtatg      7320
     ctttacacct ttttgcattt tacaaatttt gaatagggga ttccccgtac atggtaatgc      7380
     agttgttaat tcctcgataa ccgcacggat ctgatgcgga tattttttat gtaagaaacg      7440
     atacatccca ccgaagtgag ttttgtttcc tctttcgtcc tgcttgtcca aagaacgctt      7500
     taatgttgtt tccgtatgtt gttgcatcgc aatgtctaag aaaagtttct tagctgctat      7560
     agatagctta aagaaatcct ttgtaaatat aacaggacta atatatacat acggatttgc      7620
     tttttctgtt tcctcattca taaaatgagt gagtttaatt gtataacgac catctagtcc      7680
     gttttcaatg gagataatat tatgtaagtt taatttcttt aatgcgatat agaattgaga      7740
     gtgttggata taagcaaatt cttctttata ttgcttgtaa tcttcccaca tcatatgtat      7800
     ggttacattg ggaatgacac cattagtaaa gcatttctta tgcagatata agaatacttc      7860
     gagatcagca tttgtaatgc cgtataattt atgctttctt ccagtttttt ctgcaagtgt      7920
     agacattgcg cgacgtgaaa aagatggttt agctttttcg acaaagcctt ctacatcagc      7980
     aatacgttct tcgtatgtca tgtgctgcag aatatcttcc aaatatgtat ctttatagct      8040
     gtagtatttc tcctcaaacg ctgcaacaaa tttctgccaa gattttaatg tgactacaac      8100
     agcatttgtt gtttttccat ttaagctacg ctgattttga ataataaatg atttccccat      8160
     ctttttcacc tccgttctgc aaattcagaa acatatgcta aaatactgta aaatatacca      8220
     attttgatta tagcaaaata aattttgcaa aaatgcgccc tttaagagag attttaaaaa      8280
     aaagcaacac tttatgattc ttagagctac aagggatttg catttttttt tttttttttt      8340
     ttggtacgcg acttgggaag ggtgttgctc ttatttgatg agactttatt aagtaaaaat      8400
     taaaagaaat cctttaataa cactattctc taagttcatc tattattttt aggtacgcaa      8460
     tgtgggaaga gtgttgctac tttttttgaa aaataggtac gcgacttggg aaaggtcgct      8520
     ataaaaatat atataatttt ttattgaatt tcttaaattc cttgatatac aaagggatag      8580
     tagtgattta tctagcgaaa taggtacgca acttgggaaa aacgttgctt atttttaatg      8640
     tatatctgta gatttaaatg taaaatgttg cttattaaag ataataggta cgcaacttgg      8700
     gaaaagcgtt gcttttttga taagaagggt atgaaatcgg gcgaaatatt gccaatttta      8760
     caaaaaatca catctttttg ataggtgaaa aattctgtct cagaactttc taagcttaac      8820
     tctaaaaaat gaacaaggag aattaatctt caaaatctag aataagaaaa ataagtacat      8880
     acaattgtct tggaaaatgg tatgaatgat tagtagcaat tggtataatt gtattagaag      8940
     caattaggag gattattagt ggagaagtta aaagtactat ttcaaaacac tttatatata      9000
     gcgtatcctt tatttactgg ggtaaagggg aatgataaga ttttaaataa atggcaaaga      9060
     ttttatcaag atgtggaaaa agatctacaa aaaatatata actcaactta ttcatcacag      9120
     actttcgaaa ggctagtaaa atgggtttct aaaaaagaag ccttaggatt atctgcaata      9180
     gatattctcc ctaaattaga taatcataag gaagaaattt acgaatgcct aagatatgac      9240
     ttattaatgg aatttggagt taaactgcct gttttcacaa aagaattacc tttaaattca      9300
     ggacctaaaa gtgaatatat agaacgaagt aatgcaggat ttatgtatca tttatcagat      9360
     acaattgcca agaataagtt tgcagatgac caagataagg aaggtcgtat tgctcagtta      9420
     ccggataaac aaaatagtct tgtggtagta tcttctcgcg atgatggtga tatgaaatta      9480
     cagagagagg agttgaaaaa gtggaatacg ctaattgatt ctacattttt aactagagta      9540
     atggatgatt tgacggcgga ctgcctagat attgtaacag aactatgggt aaagagtgcg      9600
     gaaaatgata agaccattgt gcctgtacat tacgaacaaa tcctagatat gtgtaatatg      9660
     aaacaaatta agaacggtaa aacttattat cgaaaagaag acagattaaa aattatggag      9720
     cgtttagctg ctcttgctag tatttttatt tatgtaaatg aagataatga gatagtgatt      9780
     ttaaatgaag aggatccaaa tgaaacttta gcttataaaa agcaaagaat tagaagatta      9840
     tttgtaatgg acgaaattat tattgcaaaa gatgttgata cagataaaac attaggtata      9900
     gagagcatga acgttacacc aggtagtttt ttatcgaaat atctatacgg ttctgaaaaa      9960
     ctgacaggtt tattatctaa aaaggcatta gagtataaca gtaaacaaca gaggtatcat     10020
     aaaaggttga caagatattt aagttggcgt tggcgtattc aacaatcata tcaacattta     10080
     acacattcat atagtattgg tggtcccaaa ggagttttac aggtaatgga gataagtatg     10140
     aaaagaaagc caagtctaat cagacaagtt tttgaaaaga ctttagatga ccttatgaga     10200
     gaccaagtaa ttcaagagtg gaaatactct cctgaaatag atgaagagaa atgtaagggg     10260
     aaaaattggt ttgaaaacta ttggttaaag ttaaaaataa ttatttctcc tacaaatgag     10320
     cttgttaaat tacaacaaga gttaattatt aagaaaagta ggaaacaggt accatttttc     10380
     attgaaatag aaggaaagca accagttatt gaagaggaga caattagtat attaaatcaa     10440
     gagaacccta atagcattga attttatatc gaaaagatga acacgtacaa agagaagaat     10500
     aataaaagta tacgtgagtt tgcaaaagaa attgagattt catattcaac actttcaaga     10560
     atgttatctg gaaaaagaaa aagattaaat gacgatacga aaaataagtt agataagtgg     10620
     atagagagac aagaggtagt gaatttatta taaatttatt gccttttgta atctaacata     10680
     tttttcatct tggcttaata taagtatatg agaaagagct gtataataaa aggaacacaa     10740
     gagggtgctt gctaagtata acctaattaa ataatgaata tagtttttaa aaggtgcaat     10800
     aaaaataagt agtcgtttgt tttcgtaatc gttgtacttt tttaaaaatc caaaacaaaa     10860
     gctgaggaac tttattcctt agcttttgtt ttggatttaa ctttaatgaa taaacatctg     10920
     tagaactggg gtatttaatt tttaatattt aaatattaaa aattggttta tttaacaaat     10980
     ctgtatattt ttattaatat taattttggt aaataactga ttgaacgata ttcaatcagt     11040
     ttatgtatct aaagaaatag caaaggaaat gagtataatc ataagtgaga gaaatatgtc     11100
     gaaaaaatat aaaaggattt ttggtaataa tagcaaatta tatttatcaa aataaaaatt     11160
     taggaggttt agatggatac atttcgagat aaattaaggt tgggtgcaat agatattaat     11220
     cagaatgata aaaatggagt atttctacgt caatttgatg aggttcgata taaagaagaa     11280
     aagtatatca ttatttggca tccaatatat gaggagtttg ttgcatctca tcatacaaga     11340
     aaattcattc catatgaatt gttgaataga gttgaatata aaaaaaatct aaaagaaaat     11400
     gtacctaaat aattatgtac caatagtaaa attaagaata gaacttcaaa tattaattat     11460
     agcaaaaatc taaaaaaatt ttttttgaaa ggtgagtaat gcaatgatta ataattggat     11520
     gacaattatc gaagttgaaa aggtaacaga aatttcatat gtaatcataa gacgctatat     11580
     tagaatgcac ggtcatcact taagggtaaa aaaacaggga aaaaactact tgatttctaa     11640
     ggaatacatt catattttat taaaaatacg attgtattat caggaaggaa aaacgacaga     11700
     gcaaatagag gatgtgctct gttctgtaca tatcttaccc aaaataaata ttaatgaaaa     11760
     tgaaaagtct atggtactta atgttacaga gactttaata catatgaatt caggtttgaa     11820
     cgatttaaat agaaagtatg atggattatt acacgaattt gaaaaacaaa aagaatatat     11880
     tgaggatgta ttaacaaaaa gacagcaaaa attattgtta aagtttcagg aaacggaagg     11940
     attcaatagt aggcaagata aaaaatggtg gaagttgtgg agactataat atttacaata     12000
     cagtatttga tatactgaga gagaagaggg agaattattt agttaatgat gtacatggtt     12060
     gtgttattat atttactctg aagctaatat tttcatcgtg atacatggta caaaatatta     12120
     gtttgatcaa ggatatatag cttctaaata tctcacaata atacgattat ttgttcgtta     12180
     gttttgttta ttagtttttg gtttaaacca acatgctctt atacaataga gaggtgcggc     12240
     actaaaaaac tcaattaact ggtggaagta gggattttac cagcaaaggc aaacagaaat     12300
     tttggtatta ctgacttttg agagggcagt gtagtattac tccttctact ttgagaacaa     12360
     tttgcaagaa cttactgatt cttctatgtc tcccatcctt aaagtttcac ttgggtcttg     12420
     taagtaattg tttaattcac aaaatctgta attatttttt gtatttaatt agttctaagt     12480
     actaagttga ataaatagat gctattcaaa cgatttttca aagtagaatt ggctgcttgc     12540
     cacgatgaac atctacgtgc gactacagtt tataggaata aaatatattc tattaaagct     12600
     ataacagtca tcactttgat aggtttatct agtggttctc gataagactt gataatacca     12660
     gtaagtattt cttgtaacaa gctgtacaca ctcgttgttc ataatatttg tatagtttta     12720
     acatttacta acccatactt tttacgttga tttttaatat agtactctac tacatctatt     12780
     ggtgcccctt ctgtagtaat taaacaaaaa cctctcgatc aaaacaattt tctctaaagt     12840
     ttctttctta ctccatgaga gattctattt ataaatgaaa aattcatatt tatatgcatt     12900
     aatgaaattt ttcatttttt aattatgatg tcgcctcaaa caagatatgt atctgttcaa     12960
     catcataagt ctattctact aattttacat tttgtttctt gaataattag atatctatgg     13020
     atttttcata gtctgatata tcatcacaca catattttcg gtgttttata actaatacaa     13080
     tagcaattac aaatggctat tattatcaaa tttcagtgct atatcaaccc ttataattta     13140
     ataaaactaa ttatataaga attagaagtc tatagtgaaa ctagatgttg tttgattatg     13200
     ccaaattgaa acttatcgct gagttattgc cctgcacctg ctcgagaaag gagaatcctt     13260
     ttggagaatc tgttaaaaat gaatcttata atgagtgtct gtatatatta gtgttttttg     13320
     tatagaataa aatagtgttg cttaagatcc taacgtcaga ccttaagacc atgttctaga     13380
     aacatctgtt tgaattgctt ctttgtgacg aatgtatttc tttctttatt ttctataata     13440
     atggcatgca ctcctatttt tttctcgttc atatgtatga tttttttaag tacaaaagat     13500
     tagaaatgtt taagaagtta atggaaaaaa atacataggg ggaactttcg gaggaatgga     13560
     aaattaatca ataaacaagt tagttatata aatataaact aataatatta taataaaaat     13620
     aaaagactag cattgggtct ttaaaaacct tataatctct taattcatga aagtaatttg     13680
     tataatcagt ggaaaaggca gattaaatca tctagaatgg cagttttaat tactaagagc     13740
     gtatttgttt aaatattttt aggcaagtta tacttcattt ttaagtggtt caggatgtgc     13800
     tgataaacag agacttgttt atagttaaca gatttttgtg agttatcttg atttgaagat     13860
     aaatatttct atgttaatat aaattttagt ttattttatt tgtatgttta tactttcaat     13920
     actatattgt aatttcgagg aataatcaaa taattagaat attagaactt tagggaatta     13980
     ctaataagat atattcctgt tataaataag aatctaagtt cacttaaaat ataatattct     14040
     aatttttatt ttcggaattt cgatttaaaa agaataccaa ttatattttt gacatatact     14100
     ctacaaaagt agcacctact tttgttttca ttctatgaat cttgtgaaat tagagtttgt     14160
     agaaattgtt tctaatataa acaatatatt ttgaggggga gaaatggtgt taagatcacg     14220
     cgataagaaa attatacaag ctttggatct ctttaaatgt atgactaggg atcaaattgt     14280
     tcgtttgttg ttttctgatg tgaaaaaccc tattacatct gcaaattttg tgctaaaaag     14340
     gctgaggaga gatggatata ttgacgccaa gatagatgaa cagccatata tctattttcc     14400
     agagccatct agtgtcaaaa agacttctca aaaaataaaa cattacctag ctattgttga     14460
     tttttatatt ggtatttgtc agtataaatc cccgtctgtt tttgtagtag aaaaaaggtt     14520
     tggttctgga tatatccaac ctgatatttt catggtgtgg aacaaaatgg cattttttgt     14580
     tgagattcaa ctttctagat attcttcaga tctaatgaaa aataaattga aacgatatat     14640
     aaattatttt ggagctgaag agtggaattt caaaaataaa acatatgaac ttagtacttc     14700
     accgtatgtt tggattgttt cgaaatcgcc ctatgctata tcggaagaaa aacttcaaat     14760
     tattcaaaca tctagagcag aaggtatttt gcataataag accatttcaa tcaaacatgg     14820
     ttaatatatg tatattgctc gaattggttt tgtataccat aaatttatat atttttttcc     14880
     aattgaacca ataaagagct tgaagtgaaa taatatgaaa aaattaggta aaatgtaaaa     14940
     aagaaatggg tttatgtagg gggggaagga tatgaagaat aggattaaag aaattagaaa     15000
     aaaaaatggc gatactttaa aggatttagc aaaaaaaact aactatgatt acagtaatct     15060
     atctaaaatt gagcgaggaa tatatacccc ttccctaaac atactgaaaa aaatttcaac     15120
     tatatataat atagatattc agtatctgat tgaattggat gaaaagtgcg aagatgaatt     15180
     aaatgaaaaa gagttcatcc tagacataaa tttgaactcg caagaattac tgaaaaaata     15240
     taatttaatt ttggatggta aattagctac agaagatgaa atagaattag tggtacaaat     15300
     cattcggaag ctacgtgaaa ctttagaaaa gaaaaaaaac ggctaaaatt ttatgtaggt     15360
     agttactatg tatttttagt aatatttttg attggtatat taccttattt cgaaaaatca     15420
     ttacttgatg taggataatg ttttggcatg tagtatgaaa aaaataatta tattgtatgg     15480
     attagtatat attttatatc agaagttaaa gggaaaacct cctgctttgg ttggaatggt     15540
     aagaaaaata accataaatt tttcttacgc gtaaatccgt atgtattaaa ataggggcat     15600
     ttatataaaa tcaaatctat ggactatagg tatatcaaga gcagatagta attctgaatt     15660
     aggatttatt gggatacaat gcccctgcac tacctctttt tccttttcaa cataaatttt     15720
     tttaaagtaa ataatatata tatgcgtgtt aaggttaaat atatataaat tggattgttc     15780
     atttttccat gctagttcat aataggtgta cattttatta aatatttcgc gatttatgca     15840
     tatatcttgt agccttctgt taataaaatg ttttttagat agttgcatgt tatctactaa     15900
     agcaggatca atgtaggtgt aataaaaatc ttcatcaatt tttgtaaaac gaaatgtcat     15960
     tatagtgaat gcttgttcat attgttttag tgtattaaat acaacagaat ttaaatttat     16020
     gttttctttc ataataatct cctaactagt tttaaaatgc aaatacagaa aagaacttaa     16080
     ttccttgaat ttataatgtt atttattttg gttaaaaata aataacaatt tgtttaaaat     16140
     aacataaaaa aacatgggaa ttcccgcaat tattaaaggc tcaaaatcac cttatctcgg     16200
     agatatttaa tggtattact gcaattactg aaagagaaag taattaaaat aaagatatta     16260
     ttgctataga atttggaata tctcaattta ataaaagtcg cggataattg gaagttaata     16320
     gagatctctt taagaatatt attagtattt tccatgatat atgcttaaat attaaatgat     16380
     ttttagtatt tatccaatta ttttttgtgt agatattatt ttatatacat acggtacatt     16440
     aagcatgaag tattgaacct ttttgttctt ttgcaagtgt aataaataac ctaagcatca     16500
     taatacgttt cttatttaaa aaagcaggta atgcttattt gattttacaa catccttata     16560
     ttttttatag tgggtaggtt aataagatta caagttcgta gcactaggta ttggtttttt     16620
     atctgaaaat taagtcaact taaaatatca attttgactt ctcttaaata tcacttcatt     16680
     tctaatgtat tctactacta ctttcttaga gtaaatatat tgattaattc cttgtacggc     16740
     atctcctttc atcaattagt atattttatt ttgattatag ctattattat attttatgca     16800
     aatttataaa aagcgtagca aaagtaatac agttttaaat agtttacggc atttaatttg     16860
     tgtagatata ctgtaaatat gaaaatatca ttctaaaata ctatattaca aacgcaatga     16920
     taaaacgtta cagattaaaa gttcacatac attttgattt ttaaatatac cttgaatttt     16980
     ttagtaactg tacaagggaa atagtatatt ttatctgttg atcatattaa tttaacacct     17040
     tgctgtgatt taatgggatt atgaaaatat aacgttggaa tgttagtaat aataaaataa     17100
     catcccagat aataacattt ttaaaaacga atataatata taaacgattc atgagctatt     17160
     aaaatagaaa agaaataatc tttactttag atatttatat tctttaacag agattgtttt     17220
     atcgaaaaat gtggatgtgt gaagaacaaa ttttagagaa aggggaatgt agattaacgc     17280
     atgattttgg atataattta agaatggtag gtaataccac aagtatttat acttgtgata     17340
     ttaccatatt taataaatat agctactaag attagagggt tccattaata gcgctagtaa     17400
     gatctgcaat tggatactga cttgagctaa ctaatggttg tgcaaatttc aaagattgga     17460
     tgttaacatt gtagctcgca gaatcttgaa ttgtgaaaaa taaaacttgt tcctttactg     17520
     ctgatacttt aatttcaaaa ccaactggta cacaatacat aacgccacca gtttgggcat     17580
     tttggattgc aaacaggaca ttgtatgtgt aatttgtttg attagcagtt tccttgcccc     17640
     agaaaatcca tgcttcattt ttttgagtat ttaaatttgt aaacgtattt gtaactgctg     17700
     cagttaattg atctattaca gatccactta atgcaactcc taatacagtt tttaacactt     17760
     ctaagacttt attaatcata acacttactt ggttattcgt ttgagttaca ttttgatcaa     17820
     cataactcac tacagcaccc atcggtgtaa ttgtgtttgc gatttctaaa ccttttggca     17880
     tactaaagcg tagggcatca ccaaaatctg tagaagtggg aactaatgca ttttgaaatg     17940
     catttgctaa cataattgct tgcaatatat aattcggatt atcaatttcg ttaatagaaa     18000
     gaagattatt gatttcattt ggatcctcaa cacgtaatgt aataaccctt gctgttgatt     18060
     gaggggtttt ccatggattt acctttatat cttctaatgg acaatgattt aaattttcca     18120
     taaataaaca actccttaag ttaattagaa tagtggcctt tcaacattaa attatgattt     18180
     taaacttgca attattaatc aaatataaag taacataata aattaaattg atagacttaa     18240
     ttcacataat attatttaat gtatacattg gtgcatgttt aagaattaat ttataaggat     18300
     aacgaatact ttttatctaa atcccctcac actaaagttt ttttgtatac ttgaatatac     18360
     ctcctaaatt ttatttgttt ttgattcacc gtagtattct atgcgctata gttcgaaaga     18420
     tgcctgtttt tttagtatgt atgctctttt aaagcaatat atattttgaa taagttttag     18480
     aatggtattg ggttttgagt aatatatttc acaaattgat agattgaatt taaaagacgc     18540
     ccctaatact tcataataaa ctaaaacatc tctattacct ttctcaggca ttcaatcata     18600
     tttaagtttg gaaaatttga aatcgaaaaa ttaaagtaag ccacgtctat tctacttaaa     18660
     catgatctaa atccctttcc atattgatat tgcagattat cctcacaagg aaaacatcct     18720
     tattttgcat atgctaaaga ttcctaacac gataaaattt taagtgcttt ttgcaaacta     18780
     ggtatgaatg atacgtttgg atatcgccaa aatgaaatct aatttaagag tatgtatttt     18840
     cataaaatag tttcgtatga gattttatta ttttgaaaca atatttctta tttttatata     18900
     cataagtagc atttattcag agaagactta tccatcggaa gatttttcaa atggctatat     18960
     gatatagtat cttgtttttt tagtcaaaga tacatttttg tttatacatg catcgttttt     19020
     atacaagtaa catatatttg ttatgtaaca ggagaatagt gaaattggta ctaaattttt     19080
     aagaaagata ttttgaaatc ttatttgaat aagtttttta aaattgcata gaagggagag     19140
     aagataaata tgaatatgaa ttttgatttc gaggatcatg aaaataagaa tttatctgtg     19200
     caggaggaac atcaccattg tagtgaagga ggggaacata aaatagcatt ttgttgtgta     19260
     gtctcaattc caaaaggttt taaatatgtt gcccattgtg atccgaaatt tgtatataac     19320
     cttgattgtc tatccgtttc aaaagaaaaa tgccgtaagg ttgttcctat agaaggatgt     19380
     ggatgtgcag aggtagattt acatgtatta aaggtaaagg gatgcatctc atttgtatcg     19440
     aatatagaaa tagaacctat tcatgaatgc atgacctgct cagcaaatcc acataaagaa     19500
     aacattgctg tgagttgcca agatactgtc tgcgtagatc aagttttgta ttgcagtgta     19560
     gattgtttgc cagattgtga tattaattgt gataatgtaa aaatttgcga tgtgagcatt     19620
     gaaccaattg gagattgtga ttgtcacgcg gtgaaaatta aagggaaatt ttcacttcac     19680
     tataaataaa aaatccctaa ttattaaatg aataataagg tcataattta tgaataaaaa     19740
     tatgaccttt aaaataaaaa aattcaataa aaggtggaat gaattatatg gaagatagtt     19800
     ctttagatac tttaagtata gttaatgaaa cagactttcc attatataat aattataccg     19860
     aacctactat tgcgccagca ttaatagcag tagctcccat cgcacaatat cttgcaacag     19920
     ctatagggaa atgggcggca aaggcagcat tttcaaaagt actatcactt atattcccag     19980
     gttctcaacc tgctactatg gaaaaagttc gtacagaagt ggaaacactt ataaatcaaa     20040
     aattaagcca agatcgagtc aatatattaa acgcagaata tagggggatt attgaggtta     20100
     gtgatgtatt tgatgcgtat attaaacaac caggttttac ccctgcaaca gccaagggtt     20160
     attttctaaa tctaagtggt gctataatac aacgattacc tcaatttgag gttcaaacat     20220
     atgaaggagt atctatagca ctttttactc aaatgtgtac acttcattta actttattaa     20280
     aagacggaat cctagcaggg agtgcatggg gatttactca agctgatgta gattcattta     20340
     taaaattatt taatcaaaaa gtattagatt acaggaccag attaatgaga atgtacacag     20400
     aagagttcgg aagattgtgt aaagtcagtc ttaaagatgg attgacgttc cggaatatgt     20460
     gtaatttata tgtgtttcca tttgctgaag cctggtcttt aatgagatat gaaggattaa     20520
     aattacaaag ctctctatca ttatgggatt atgttggtgt ctcaattcct gtaaattata     20580
     atgaatgggg aggactagtt tataagttat taatggggga agttaatcaa agattaacaa     20640
     ctgttaaatt taattattct ttcactaatg aaccagctga tataccagca agagaaaata     20700
     ttcgtggcgt ccatcctata tacgatccta gttctgggct tacaggatgg ataggaaacg     20760
     gaagaacaaa caattttaat tttgctgata acaatggcaa tgaaattatg gaagttagaa     20820
     cacaaacttt ttatcaaaat ccaaataatg agcctatagc gcctagagat attataaatc     20880
     aaattttaac tgcgccagca ccagcagacc tattttttaa aaatgcagat ataaatgtaa     20940
     agttcacaca gtggtttcag tctactctat atgggtggaa cattaaactc ggtacacaaa     21000
     cggttttaag tagtagaacc ggaacaatac caccaaatta tttagcatat gatggatatt     21060
     atattcgtgc tatttcagct tgcccaagag gagtctcact tgcatataat cacgatctta     21120
     caacactaac atataataga atagagtatg attcacctac tacagaaaat attattgtag     21180
     ggtttgcacc agataatact aaggactttt attctaaaaa atctcactat ttaagtgaaa     21240
     cgaatgatag ttatgtaatt cctgctctgc aatttgctga agtttcagat agatcatttt     21300
     tagaagatac gccagatcaa gcaacagacg gcagtattaa atttgcacgt actttcatta     21360
     gtaatgaagc taagtactct attagactaa acaccgggtt taatacggca actagatata     21420
     aattaattat cagggtaaga gtaccttatc gcttacctgc tggaatacgg gtacaatctc     21480
     agaattcggg aaataataga atgctaggca gttttactgc aaatgctaat ccagaatggg     21540
     tggattttgt cacagatgca tttacattta acgatttagg gattacaact tcaagtacaa     21600
     atgctttatt tagtatttct tcagatagtt taaattctgg agaagagtgg tatttatcgc     21660
     agttgttttt agtaaaagaa tcggccttta cgacgcaaat taatccgtta ctaaagtaga     21720
     agtcatgtta gcacaagagg agtgagtatt gtggctcctc ttgtaatttt aatcgctaat     21780
     atttctaata gatataaatt atatataata tttaaaaagt tataattatg taattgtaga     21840
     aaatcatgaa tttttcaatt ttattgacga ggaaacagag tatacgagtt tataatttct     21900
     aataattgtt taaaacatat gcttagaagt caatttatat tagctttact tttagtagaa     21960
     tttataatta atatttagga taaaattgga ggataattga tgacagaaaa tggagtgttt     22020
     tataaaatat tcacaacaga aaataataat ttttgtataa atcctacttt gttagaaagg     22080
     gtttttaaaa ataatttaga tgaatttgat ttttcgctag taaaaaaaaa cttagaacat     22140
     gagaagaatt gtgtgattac ttctacaatg aatcaaacaa tttctttcga gaatatgaat     22200
     agtacagaaa tggggcataa gacatattct tttttaaatc aaacagtatt aaataataag     22260
     gggaattctt ctttagagga acaagtctct aatatttttt atagatgtgt atatatggaa     22320
     gttggaaaat caagttcata tattaaacct cttgagcagg attctaataa aataaggtat     22380
     gtttgtagtt tgctctttat agtgccctat aagaataaca taacatcaat tattccagta     22440
     aatttacaac taacattatt atcgaaaaat gtaaaacaat cctcttctac aaatatattt     22500
     tcaggagata tacattttaa tatggtaaca atgacttatt taacttaatc ggaacgttta     22560
     acctttcaag tagagataga aaagctataa ccggacaata tgagcagggg ggggggagga     22620
     tgattttttt atttattata aaaaaattta tatgtaaatt gaatgcactg gaaacattag     22680
     tatgggggta ataaatgtga atcgatataa taactcagat gaatttgaaa taattatgat     22740
     atatatatag aattaaataa tcaaattcaa caagcatttt atctatatga cgttcgaaat     22800
     tttattaaaa atggtgactt taaatatggc ctagaggagt ggcatgtcaa aggtgatgca     22860
     aacgtacaac aaataaatgg tacacctgtg ttagtaattc ctaattggag tgctcaagta     22920
     tcacaaaata tatgcttaaa cacgatcatg gatatgtatt gcgggtgaca gcgaaaaaag     22980
     aaggtctgag taatggaacg gtgacaatct ccggtgatgc aaatcaatag aaacgatttc     23040
     atatacaact tgtgattata atacaagttg tatatgagca aatagaatac acaacgaaaa     23100
     ccatagaact tttcccagat acagatcaag ttcgtgttga tataagcgaa acgtaagaga     23160
     tgtttaaagt agaaagtgta gagttaattt gtaaagaaga gtaaattatt ggttctaatt     23220
     tttaaagacc taaaaggtaa aaaacggaag ctgctaataa ttgttataat tctatataca     23280
     tggtaaaggc gaggtttaat tgaagacttc gcctttttta tagaaggggt acggcaacat     23340
     cgccatcaag ctaacgaaat tgaacttaca aaaatacgta taaattcctc tccgactatg     23400
     gaatattggg tatcttttac ccaatattaa aattttttat aaaaaagtgc atacgaaata     23460
     accctagcgg gctacaattt ttttaagcgg atttattttt ctatatactg ctcgtatgca     23520
     gtacctaaaa tatcaaatac agtttttttt cgataacgat gtgattttcg tccattttta     23580
     tcaagtaagt ggaataaacg aagaaaactt gttattagtt gcttcgattg ttcttgtatt     23640
     tgtcgatata atacgcggaa ataatcatga atcatataca tagctttcca ttcacttaat     23700
     tctttttgtt tttttatcag caatacttgt ctcatttgga acatcacagt agaagagagt     23760
     aaaagagcaa ttaattttcc atagatatga cattctaatc gttctttctt cacatttgta     23820
     ttggaatgaa tgcgaaaaat agatttccat gttttaaaga taatttctat ttgccaacga     23880
     agagagtaga actcatggat agcttcttta gaaacatatt ccaatggaat attcgtaatg     23940
     tatacattga tgccttgtaa tttttttgtt cgatcactaa acgttatgtt tttctttttt     24000
     tctttgtatg ctcgatcttt tctacgttgt gtttcctgat caggagtaag cctatacatt     24060
     acagctctta cgggaagtag atagtcacgc ccaacataga caacaggaat ttcatataat     24120
     tcccctggtt gtaactgttc cataatcgtt tctaaatcaa tcattgtata ttgatatttt     24180
     tttttacttg ctccattttt aaaaataggg gcctcttcat tttttgaaac agtttggtat     24240
     tcattttaag ccgagataaa tagtaggctc ctttttgttg gatgccatct agatcgatca     24300
     aactaaaata acctaaatcc cgtatacaaa gatcttgtaa atcaacggta ggttgaactt     24360
     ctttgccgta attcacatca ttttctttcg caggtcccaa tgcaacatgt aagaattgac     24420
     cactcagtaa atcatattct aattgtattt tcactccaga agcttttcca cttccgcctg     24480
     aaccaggata aacggctgcg agttgatctg aaatttgaaa tgtagtggca tctaaaatac     24540
     gaatacgccg aaagtattct gaaaaagaag aaggtagaga tatagtggct aataattgtt     24600
     tttgtaagag ttgcgagaag agcgaacgta aaaattctac tgctttttcg tttaatcgta     24660
     catttagtcc ttccggacta ataaggacac ctgtttctga ttctaaaaca ccacatagtc     24720
     ttgtcaaaga ataacttgca atatcttggc ccattcctat gcataaagca gctaaatctt     24780
     gtgctccaaa tttactggta cgttgaacaa actgtgtttc tttccccaaa tgtgttaaaa     24840
     agtgtgatga aaatacacgc tgtaattctt ttacaagtaa acgaaagtct ttaaaatgag     24900
     atgatttttt catggattcc cctccatttt tatctttatt ttataaaatg aagataaaaa     24960
     gaaaagaggt gaaagcttat gtgtctatta ggttcagaaa agaatccgat tatgataaaa     25020
     gtaggaacaa gagcacgagc agaaaaaata gcagcaattt gtgatgatta tgatttgtat     25080
     tacatcatta gtttagaatt aaatgaagat ctaacagatt tgaaaaaagc gatgaaagga     25140
     cggacacgtc caatggatat atatgataca tgtgcttgta acagtggaaa gaaatataag     25200
     ttctgttgca tgagcaaaga aatagagtta gatatataaa aagagatacc cctattttat     25260
     tcggtttggg ggtatctcct tttccttagc ttgatggcga tgttgccgta cccctagaag     25320
     gtataaagct tatctttttt tatggtattt gaattccaaa ttatgcttga aatcgttgat     25380
     gtgtagtcaa ctgataacac atacgcaggg aacatttaca taatgaactg tacaataagt     25440
     tatatgggca taaagtatat tctcttttaa ctatttagaa aagatagtaa tagtgagact     25500
     gtttttttat cagaatcgtg tattttccat actatttttc agaaaagttt ataaattccg     25560
     ataatattaa tttttgtgaa atggaacaac tagtttgttt cagttgtgat acatcaaagt     25620
     aattaaaaaa taaaataaca atattatcca gatgatataa cgttaataac ttgttggata     25680
     tgtttgcctt taaaatatac gatctggtag tcttgtaatt tcatgtactg aattgaattt     25740
     tcataaaaat attttggatt aaatttattc cccctgcacc tttggaatag ctgttacata     25800
     taatatttca agatacaatg attataaata aagtgaaaag gaatgatatt aatggggatg     25860
     ccaacaattc cagaaggttt agatattact agagaccaag caattaatat tattttagct     25920
     tctattggat tagaagaatt agggctagct cacgtaatta atgcagaggg cgaaaaggtg     25980
     caagcagttg tggctggatt tgaaaaagaa acagttacct ttgaccaatt attagctaca     26040
     aatgaaagtg taacccaaac tcttaaaacg gtaataaaaa aggaaatgtt attacaattt     26100
     aagttagaag aagctaaatc gctaatacaa tcatcttcgc caccttctat ttcttagtat     26160
     aaaaaataag tttaatttat tgcatgtaaa aaaacaggag tttgctattt aaaactcctg     26220
     ttttttgcac ataacaaatt acggcaattt attaagagct gaatataatc tagctgcctg     26280
     tagccagacc ttatatcttt ttaaaagttc tataatataa attttaaagt aaaaggagaa     26340
     tttttaaatt ttaattctta atttcatggg aatattcggt gtgggaaatt aatttaatct     26400
     ttttttccaa gccccatagt ctggaaaatt tccttgtagt tgtgataaag tatcgtcagc     26460
     ccatgattca ccgctaaaat ctcccagtat gatgcgatgt gcattacctt caaggcattt     26520
     tgtccaaact ccatagcctg gaaaaatctc ttttacttta cgcaaagtat cagcagtcca     26580
     ttcgatactg ttaaaatctc cgagatgaat ctgataaatg ggtaccaatt tatttttatc     26640
     tacttttggc tttaatccaa agtattcagc gataccatgt gcatgtgctt cagcaacatg     26700
     atatagaaaa gtggcattat taaattttaa tatttcagta tgattcatga ataagttttc     26760
     tgttagaaca gccggcatgt ttgttcctct taaaacggca aatgaagctt ccttcattcc     26820
     tcgattacga agtccatgtt tagcataaaa agaaaagata gaatggtgtg tcacttgctg     26880
     taaacgtagt gtatcacctg tagtaccagg aaaacgaaat gtttcaaatc cattaccggg     26940
     aacaccgttt gtagcaccac tattacaatg gaatgagaca aatatatctg cgccgaaccg     27000
     attggccata ttgcatcttt cttgaagagt tttaaatgta tcattaaatc tagtcatacc     27060
     tactatgata tcgtcataat gttcatttaa atattcatat gtagataaag caagttctaa     27120
     cacaatattc ttttctaata aggaatgccc aacggcacct gaatcatgtg caccgtgtcc     27180
     agcatctaac caaactttaa ccatatccat cgctcctctt ctcttagtac tttattatat     27240
     gtagtaacat ataataaagt acttgaaatt tagctaacat gtaaaagagt ttaatgaaga     27300
     gaatcatgta tagagagttt tataagataa taattcaaaa atagatatta aattggtagc     27360
     ggttggccat aaaggctttg ttaaagtaat agaaaaatat aggagtaatt taagtggata     27420
     ggatgttaaa gtcaatcttg aattattaga gttattcacg cattaagcga tattgtctta     27480
     aatttttagg atgttaagct attcgttata tttcacatac gatcaaagaa atcaatatgt     27540
     tctaaagctc ttttgtccct tatgtatctt ctgaaagaac tatttttgca tatatgggca     27600
     tagtagtgaa tataatgttt actacttgtc aaatttaaat ggtcccaaaa tataaatgag     27660
     gggtgaaata aatgggaatt ccaaatattc cagaaggatt ggatataact cgtgagcagg     27720
     caattaatat tatcttagca tcaattggat tagaagaatt aggactagcc cacgtaatta     27780
     atgcagaagg tgaaaaggtt caagcagttg tgactgaatt taaaaaggga aaagtatcgc     27840
     ttgatcaatt gttggcaact aacgagagca cggtagatac tctcaaaaca gtaataaaaa     27900
     aagaaatgct gttacagctc aaactagaag aaactaaatc aatattaaag ttatgtagtt     27960
     gtagaaagtc atccgattat taagataaat agttctgttg taaaattttt tacattaaac     28020
     aaattcaaaa atgcgaaatc cttgtcattt aattgttaat aaattctgta attcagttta     28080
     agcgggacag atggattcta ttcgaaggct gtgtttttgt tgatgtggag catgattttc     28140
     ttttgttcct ttttatggaa agtaagaagg gaggttcgaa atcttatgga tgtagccaac     28200
     ggctaccaaa ataatatttt tcttgaaaaa tgtctcttta aaatatttaa ttattcccct     28260
     cattaatttt acaaatttat cttactgcag aaaactttac aacagaacca tttcgtataa     28320
     ctccttacga tgcacttaat tttgataaaa ttgagtataa ttcatataaa tcactctaat     28380
     gtatacaata acagatttgt agaatctacg ttttgtaatg gcttgtattt aatgggatat     28440
     ttctctgcag tactataaat aaagccacaa aaacatgtac gtgtgtataa tgtcctatga     28500
     ctgatggtaa agtgctgaaa tacgagctgt aaaaaatagt ctacagctcg tatttagata     28560
     gaaaaagtat atttttataa attggatagg aaccaatttg tcccccatat tcattctgtt     28620
     tacatgagga gaagtttcta gttcacatga caagatggag catatgaatt tttatattgg     28680
     cttttatgca gttattttgt atactaaatg tgagtttttc ttaaagtagg caatatttta     28740
     gtctctatga aaacaaacta atctgttaat tatatatgtg gtaaaacaag cccttatgtc     28800
     aatgtacata agagcttgtt ttgcatgttt accactattt tatgtacaat aatagaaaaa     28860
     catcatatga gatggggagg ggaaaaccca tgttcaacca acaattagtt aatttacgaa     28920
     ttgattttgc ttttaaacaa ttatttggta caagtggaaa tgaagatatt ctggttgctt     28980
     ttttaaatgc catgttacaa aattcattag aatcatcaat tgtttcttta caattagaag     29040
     atccgtactt acaccgggag catgaagaag ataaattatc aattatcaat tttagatatt     29100
     tcagcggcat tagatacagg aacaaaggta aatgtagaaa tacagcttaa taataatcac     29160
     gatatgatta aaagaagctt atattactgg ggaagattgt atacttctca attacaaaag     29220
     gggatgcctt atagttttct tcatcaaaca atcacgatta atttattaaa ctttgagatg     29280
     tttccaaaac atgaagcatt tcatacaaca ggaatcttat ggaatcagca acaacaacag     29340
     gtattaagtg atgatataga aattcatatt gtggagattc ccaagctaat gcagcaatgg     29400
     cgtaatgaac aaattaatcc ttgggaagac tcttttgttc gctggttatt attactcaca     29460
     gcaaatgaag atgaaaaatt aacccaaaca ttggaggata ttgccatgaa ccaagatcca     29520
     attttacaaa aagcaatgaa taaatgggaa cgtatgagtc aagattcttc tttccgccaa     29580
     gcgtatgcag cgagagaaaa agttttaatg gatgaagctg caaaatttgc ttatgcggag     29640
     caaacaggta tcgaaaaagg aaaaatgcag cttattcgtg gtatgcataa aaatggaatg     29700
     gcaatagaag atattgcaaa attttcagga ttaacagaaa tggagatgcg acgattctta     29760
     caaaattaaa ttgctgagtt actataataa cttttataaa atccccttat ctttaataag     29820
     gggattttta gagtgctgag aaacccttta gggtttccaa tattcgtaat atatcctttt     29880
     tcacaagacg taaacgtcag cctttcttaa ttctcctaac aatccatgag cgtaacatac     29940
     ccatacccag gtcctctttt attttcatca tatgttataa taagtcgatt taatatatat     30000
     gctagttatt tttcaaaacg ttcgtattat tttatgcgca gagggtttgg ctacatagtt     30060
     attcgaacag ataaataaat aattaattaa caagtattac taaaaagaga cggagttaaa     30120
     ttgacctcgt ttatcaacgc gctgaaaaaa agaaaatatt atctagttta gattcttcat     30180
     ttttttagta aactggataa aaattttgag cgcgtttgaa aagaagtaaa acatcttaat     30240
     acaaagagct cctaatagaa ttatttttat ttatctctct aaagtactat ggctatttct     30300
     agttattttt ttataaaatc ttacgatttt attggattaa cattcagatt ttgaagaata     30360
     ttatgatttg gacgatgtaa gctatagtta cgaacattaa atacatctat aatgggtgca     30420
     ttataagaat ctaaagcttg aactacagta agagctttca ttttaacttc atatcgtgca     30480
     ctatctttta ttgtaatgaa taataattgt tgtttttgaa catccacagt aatttcaaat     30540
     gctataggca atattgccat aaatctacct gtatcttcat tttgaataga aaataaaatt     30600
     ttataaaaat aacttgtttg agtagctgat aaattacgcc aaacaatcca attttcatct     30660
     acttgaggtt ctaaatttgt aaatgtattt gtaatagcag atactacgct gttccaaaaa     30720
     ttagcactat tgataacgag ccctagcaca cttctaataa tttctttaat ttgactaatc     30780
     ataactgaaa cttcaattgt ttgatgaatt acactttgat taatagttcc tgtaactcct     30840
     gcattaggaa gaccatttgc aatttgtaaa gctttttcaa aattgaaatt taaggtaagt     30900
     ggatctatag ctccttgaaa tgtatttgtt aaacgaattg cttgagcaat gtattgtggc     30960
     tctacataaa aaatttcatt aaaattagtt atatcactgg atggaactgt taatgcaata     31020
     tgcctaaacg gttttttaat aataggtcct gaacagtgat attcaccatt gttttctaaa     31080
     ttattaaaat tattcaaatt attaaggtgc atattttaat aatccccctt ttaaattact     31140
     atttattttc cgaacgtacg gtctaaagta gtagtttaag acgatatcaa ctcttagcct     31200
     tgactataat tgatattcaa gcatcaatta ttttttaaca atggttcata tcttttttat     31260
     atagactccc ctccttcatt atctatgtaa ttattatgtt taatacaatt aacacagata     31320
     tatgatagat gtagttttaa atattctcat tctatgtatc tattccttta ataatatttc     31380
     tacaaataac ctcattatct ttagaaagca aaaagaatcc tttcttcgac aacgtttttt     31440
     ttattttttt cagctagtct atatgtacat aaaaaaatta gagaaagtct aaggggttga     31500
     catattgtgt taagtatggg gatttgtatg attttttaag gaggactaac aactatttta     31560
     cagagccaaa tgataaccgt gaatatgaag ttgttattga ccatgtatta tttgcgtgct     31620
     aattgatttc tttgtttatt cgcatctggg aaaacaaaag aaatgttact accggccctt     31680
     ttttatagta aggattgcga ttattcgatt tcgaaaaaaa ttggaattag ctatagacgc     31740
     gcacctatct tcaaaaacta cgagagcaag cggtaaataa gaataatcta tgtatgatac     31800
     ttagagaagg ggggaaatca tgggacattg gtatgagcta ttagtttcat tgatatgtga     31860
     tggcaagata acagatgcat aatctataat tattcccgta cagcctttag aggaagatgc     31920
     gaaaaattat aaccagaagt aaaggggatg tttaggatag tataaaaatc aagaccataa     31980
     gtgtatttat ttgagaggta cccaatataa catggaataa gataaagaaa aaactccctt     32040
     tatagagggc gtcgcacctc aataacttga aggtatatat ttattaatct ttggattgtt     32100
     attatagctg tttttttgtt gtatactccc gaaaatcgat ttgaattttc tgaatatcga     32160
     acaatatatt attttggatg cttgataacc actaacgata tgtatggaaa attattttga     32220
     agtgaaaaaa tatggtcaaa taaaaatgga ataattatat tggtacagaa atatgattgg     32280
     gattagtgag tctataatat agaaaggaat gttttgtttt ttgtatataa gttgaaaaag     32340
     atttctgtaa attgtccaga gactgtatgt gtagattgag tattggaaca tatcgttaat     32400
     tttatatttt aatataatga tatgaattat acaaggtcta gataagaatt gttcatagga     32460
     atccgtatca attttttcaa ggaatatgta tttgcacttt tggtcttttt aaatcgtatg     32520
     aattcaaaat agtttatatc aatctttgtt acaccagaaa aagattgtat ccaatgtgaa     32580
     tatgggagga ataaatatga attcaggcta tccgttagcg aatgacttac aagggtcaat     32640
     gaaaaacacg aactataaag attggctagc catgtgtgaa aataaccaac agtatggcgt     32700
     taatccagct gcgattaatt cttcttcagt tagtaccgct ttaaaagtag ctggagctat     32760
     ccttaaattt gtaaacccac ctgcaggtac tgtcttaacc gtacttagcg cggtgcttcc     32820
     tattctttgg ccgactaata ctccaacgcc tgaaagagtt tggaatgatt tcatgaccaa     32880
     tacagggaat cttattgatc aaactgtaac agcttatgta cgaacagatg caaatgcaaa     32940
     aatgacggtt gtgaaagatt atttagatca atatacaact aaatttaaca cttggaaaag     33000
     agagcctaat aaccagtcct atagaacagc agtaataact caatttaact taaccagtgc     33060
     caaacttcga gagaccgcag tttattttag caacttagta ggttatgaat tattgttatt     33120
     accaatatac gcacaagtag caaatttcaa tttactttta ataagagatg gcctcataaa     33180
     tgcacaagaa tggtctttag cacgtagtgc tggtgaccaa ctatataaca ctatggtgca     33240
     gtacactaaa gaatatattg cacatagcat tacatggtat aataaaggtt tagatgtact     33300
     tagaaataaa tctaatggac aatggattac gtttaatgat tataaaagag agatgactat     33360
     tcaagtatta gatatactcg ctctttttgc cagttatgat ccacgtcgat accctgcgga     33420
     caaaatagat aatacgaaac tatcaaaaac agaatttaca agagagattt atacagcttt     33480
     agtagaatct ccttctagta aatctatagc agcactggag gcagcactta cacgagatgt     33540
     tcatttattc acttggctaa agagagtaga tttctggacc aatactatat atcaagattt     33600
     aagattttta tctgccaata aaattgggtt ttcatataca aattcttctg caatgcaaga     33660
     aagtggaatt tatggaagtt ctggttttgg ttcaaatctt actcatcaaa ttcaacttaa     33720
     ttctaatgtt tataaaactt ctatcacaga tactagctcc ccctctaatc gagttacaaa     33780
     aatggatttc tacaaaattg atggtactct tgcctcttat aattcaaata taacaccaac     33840
     tcctgaaggt ttaaggacca cattttttgg attttcaaca aatgagaaca cacctaatca     33900
     accaactgta aatgattata cgcatatttt aagctatata aaaactgatg ttatagatta     33960
     taacagtaac agggtttcat ttgcttggac acataagatt gttgacccta ataatcaaat     34020
     atacacagat gctatcacac aagttccggc cgtaaaatct aacttcttga atgcaacagc     34080
     taaagtaatc aagggacctg gtcatacagg gggggatcta gttgctctta caagcaatgg     34140
     tactctatca ggcagaatgg agattcaatg taaaacaagt atttttaatg atcctacaag     34200
     aagttacgga ttacgcatac gttatgctgc aaatagtcca attgtattga atgtatcata     34260
     tgtattacaa ggagtttcta gaggaacaac gattagtaca gaatctacgt tttcaagacc     34320
     taataatata atacctacag atttaaaata tgaagagttt agatacaaag atccttttga     34380
     tgcaattgta ccgatgagat tatcttctaa tcaactgata actatagcta ttcaaccatt     34440
     aaacatgact tcaaataatc aagtgattat tgacagaatc gaaattattc caatcactca     34500
     atctgtatta gatgagacag agaaccaaaa tttagaatca gaacgagaag ttgtgaatgc     34560
     actgtttaca aatgacgcga aagatgcatt aaacattgga acgacagatt atgacataga     34620
     tcaagccgca aatcttgtgg aatgtatttc tgaagaatta tatccaaaag aaaaaatgct     34680
     gttattagat gaagttaaaa atgcgaaaca acttagtcaa tctcgaaatg tacttcaaaa     34740
     cggggatttt gaatcggcta cgcttggttg gacaacaagt gataatatca caattcaaga     34800
     agatgatcct atttttaaag ggcattacct tcatatgtct ggggcgagag acattgatgg     34860
     tacgatattt ccgacctata tattccaaaa aattgatgaa tcaaaattaa aaccgtatac     34920
     acgttaccta gtaaggggat ttgtaggaag tagtaaagat gtagaactag tggtttcacg     34980
     ctatggggaa gaaattgatg ccatcatgaa tgttccagct gatttaaact atctgtatcc     35040
     ttctaccttt gattgtgaag ggtctaatcg ttgtgagacg tccgctgtgc cggctaacat     35100
     tgggaacact tctgatatgt tgtattcatg ccaatatgat acagggaaaa agcatgtcgt     35160
     atgtcaggat tcccatcaat ttagtttcac tattgataca ggggcattag atacaaatga     35220
     aaatataggg gtttgggtca tgtttaaaat atcttctcca gatggatacg catcattaga     35280
     taatttagaa gtaattgaag aagggccaat agatggggaa gcactgtcac gcgtgaaaca     35340
     catggagaag aaatggaacg atcaaatgga agcaaaacgt tcggaaacac aacaagcata     35400
     tgatgtagcg aaacaagcca ttgatgcttt attcacaaat gtacaagatg aggctttaca     35460
     gtttgatacg acactcgctc aaattcagta cgctgagtat ttggtacaat cgattccata     35520
     tgtgtacaat gattggttgt cagatgttcc aggtatgaat tatgatatct atgtagagtt     35580
     ggatgcacga gtggcacaag cgcgttattt gtatgataca agaaatatta ttaaaaatgg     35640
     tgattttaca caaggggtaa tggggtggca tgtaactgga aatgcagacg tacaacaaat     35700
     agatggtgtt tctgtattgg ttctatctaa ttggagtgct ggcgtatctc aaaatgtcca     35760
     tctccaacat aatcatgggt atgtcttacg tgttattgcc aaaaaagaag gacctggaaa     35820
     tgggtatgtc acgcttatgg attgtgagga gaatcaagaa aaattgacgt ttacgtcttg     35880
     tgaagaagga tatattacga agacagtaga tgtattccca gatacagatc gtgtacgaat     35940
     tgagataggc gaaaccgaag gttcgtttta tatcgaaagc attgaattaa tttgcatgaa     36000
     cgagtgatta ataaaaaata actaaagctt taaaaaccat ggagaaagtt ttctccatgg     36060
     tttttaattt ctgcatttat taattctggt acaaaaaata tatagaaaac ataaaaaata     36120
     gatatctaga ggacataaaa tttatacaaa tatcaatttc attagtatag aacgtttatc     36180
     caataataat tatcaccatt taaactatcc aaactacaat tgtgatccaa gttatgatga     36240
     ttaatagatg aactgattta ggatttgaaa atagattttc atcaaacaaa atgagggaaa     36300
     gaatatgcag ggaaatcaac aatcgatttc aaatcttaat acttcgggat tatttcgggg     36360
     tacagccgag atacgtgtaa gaatagaccg tatccttacc tttatttcta tattggattt     36420
     attgagctta taaatattgt ttctgtggtt tcgtctattt ttattaagta aattgtctat     36480
     tatgggttaa ccctaatcat tcattagtta ctgaaaacat tttatttcat ttgtgtgatt     36540
     aggatgagtg ataatagatt caaaaacaaa aaagctggat taatgccagc tttttttaca     36600
     attataatta cccataaata taaaatatta tttttgtgtt tctctttcac ctacaaccta     36660
     agctaataat aaaatagagc tagttactaa caatgctata aaaactccca ttaaacattt     36720
     ctccttttta caaaaaatat tttaccatat tataccgcat caggacggat caaattgtaa     36780
     taacaaggag catttatgtt gcaaatgtca cagaaaaata ttttttggaa aagaatatat     36840
     aaaaatgacc tatttttaca cgtatctcgg ttgtacccca tacacagaaa cagacataaa     36900
     acagacataa aacacacctt cctttcctat gattttacat aaaaaatagc gtgttttttc     36960
     attttaagaa aatttaattt tgttagcgta atagcgatat atgtgctttt taaataaatt     37020
     attaaaatct taatgcttta agtagaaaat tatataaaac atagaaaaat tgagctatca     37080
     aggcaccttg ccataaactt aagttagaag aaagataagg gtgtttttta agatacatat     37140
     gtaatataca gagattcgtt ccactggctg aaagaacgat tattaggcct ctttgaaggt     37200
     agtctcggag ctttgctttt gaaagagtga aaattgtgcc cagtagaaag caacgatttg     37260
     gttctcgtta tcgaactaaa gtcataggac ttattgagtt tatttaccgt gaggaaatag     37320
     agaaactgag tggtaccgca ataatcacgc ctcaggaatc aagcgtataa tgcgtatttg     37380
     attgtggagg tgagattttt tattgtttaa agtaagaata atattttaaa aagatcatag     37440
     aaattcaagg caaaacagga gagaatgatt aagttattta aaatagatta gaaaaggaag     37500
     ggataataat gttttaaaat tcttttttta ttaatctaag aaaaaccgtg caggatgata     37560
     tcaatggttc tgttgcaaag tttgaaaaaa attataaatg ggtggataaa taaggggaat     37620
     aacttatgca gtggccattg attgttgtaa ttcattgtac actgaaaagg caagatttgt     37680
     ttggaaattt cgcctctgtt tatatatagc ctgaatcgtt tcgattcctt ttatggtacg     37740
     agaagcatga cgaggagttt gaaatccagc tgatttcaca aaccgacgtt tgatatgtcg     37800
     atgatcttgt tcaataagat tattacgata tttaatggta cagtgattgg tatgtacata     37860
     atactcagct ttctgtaatt ttttgaatgc acaaagtaaa gctggggcct tgtctgtcgt     37920
     aagaaccgat ggttctccaa aatgtttgac caatcttttc ataaaggcat aagcagcttg     37980
     atggattacg tgtttttcaa acttgaaagt ccagtgtatg tccatcacta tcaatcgcgc     38040
     ggtataaata acaccattct cctttgactt tgatatacgt ctcatctaaa tgccaagtat     38100
     ggagtgccga tttgtttttt ttcttccata ttcgatagat tagctggcca tattcatgaa     38160
     cccaacgcat gatcgttgtg ggatgatctg acacaccacg ttcctgaaaa atctcagata     38220
     catcacgata gcttaaagaa aaacgacagt aatagccaat ggctactaaa ataatgtctt     38280
     tcttgaactg ttttccttta aaatatctca tgtagcattc tcctcagcac attttcccta     38340
     cagtctcctt tttcgtggaa tgggcaaaaa catcctgcta ccgaaacgct ggattgtgga     38400
     acaaactttt tcttggttag aaaactaccg cagactacgg aagaactgtg agtaaacact     38460
     tgaaaatagt agacagagtt gcttattggc atctgtggtg attttattaa aaagattcta     38520
     gataggttct aagggtgaag tagggaaatg gatacctttg tgcaaacagg aggggtttat     38580
     gaaccgctgt ggtctggagt tagaacgtgg atggatgaga agggctggta ttatgaagtg     38640
     agacaaacaa tgtgaacagg atatcttcca tccaagatgt cctgtttttc tgtactctct     38700
     actatggttg gactcaaaac gcttatagaa gaatttgagg atgttgaagg gggataggag     38760
     gtgatttgat atatttttgg gaaatgtaaa ggttgattgt cggaaaatga tgaggttatt     38820
     tgtagaaaag atgtaacagg aatacatata gaaaattacg aatactttaa aatgcataag     38880
     acatattgaa aaaagaatga tcaatcacta cataggaagg aatatctata ggatttgcga     38940
     aaatgataaa ttatgtacag ataggttctt gttaagtcat atgaattaaa aaatgcttta     39000
     aaataatctt tgttgcaaca gaaaagagtt gtgtctaatt tgagtatggg aggaatagat     39060
     atgaatccat atcaaaataa gaatgaatat gaaatattca atgctccatc caatggtttt     39120
     agcaagtcta ataactattc tagatatcca ttagcaaata agccaaatca accactgaaa     39180
     aacacgaatt acaaagattg gctcaatgtg tgtcaagata atcaacaata tggcaataat     39240
     gcggggaatt ttgctagttc tgaaactatt gttggagtta gtgcaggtat tattgtagta     39300
     ggaactatgt taggagcttt tgctgcccct gtcttagctg caggtataat atcttttggg     39360
     actttgttgc cgatcttttg gcaaggatct gaccctgcaa atgtttggca ggatttgtta     39420
     aacatcggag gaaggcctat acaagaaata gataaaaaca taattaatgt actaacttct     39480
     atcgtaacac ctataaaaaa tcaacttgat aaatatcaag aatttttcga taaatgggag     39540
     ccagcacgta cacacgctaa tgctaaagca gtacatgatc tctttactac cttagaacct     39600
     ataatagata aagatttaga tatgttaaaa aataatgcta gctatcgaat accaacactc     39660
     cctgcatatg cacaaatagc tacttggcac ttgaatttat taaaacatgc tgctacctat     39720
     tacaatatat ggctgcaaaa tcaaggtata aatccaagta ctttcaattc atctaattac     39780
     tatcagggct atttaaaacg taaaatacaa gaatatactg actattgtat acaaacgtac     39840
     aatgcaggac taactatgat tagaactaat actaacgcaa catggaatat gtataatact     39900
     taccgtttag aaatgactct aactgtgtta gatcttattg ctatttttcc aaattatgac     39960
     ccagaaaaat atccaatagg agttaaatct gaacttatca gagaagttta tacgaatgtt     40020
     aattcagata catttagaac cataacagaa ctagaaaatg gattaactag aaatcctaca     40080
     ttatttactt ggataaacca agggcgtttt tacacaagaa attctcgaga cattcttgat     40140
     ccttatgata ttttttcttt tacaggtaac cagatggcct ttacacatac taatgatgat     40200
     cgcaacataa tctggggagc ggttcatgga aatattattt ctcaagacac atccaaagta     40260
     tttccttttt atagaaacaa acctattgat aaggtcgaaa ttgtcagaca tagagagtac     40320
     tcagatataa tatatgaaat gatatttttt tcgaatagca gtgaagtatt tcgatattca     40380
     tccaattcaa caatagaaaa taattataaa agaactgatt cttatatgat tccaaaacaa     40440
     acatggaaaa ataaagaata tggtcatact ctatcgtata taaaaactga taattatata     40500
     ttttcagtag ttagagaaag aagaagagtt gcatttagtt ggacacatac tagtgttgat     40560
     ttccaaaata caatagattt agataacatc acccaaatcc acgctctaaa agctttgaag     40620
     gtaagttctg attcgaaaat tgtgaaaggt cctggtcaca caggtggaga cttggtaatt     40680
     cttaaagata gtatggattt tagagttaga tttttaaaaa atgtttctcg acaatatcaa     40740
     gtacgtattc gttatgctac taatgctcca aagacaacag tattcttaac cggaatagat     40800
     actataagtg tggagctccc tagtaccact tcccgccaaa acccaaatgc tacagattta     40860
     acatatgcag attttggata tgtaacattt ccaagaacag ttccaaataa aacatttgaa     40920
     ggagaagaca ctttattaat gaccttatat ggtacaccaa atcattcata taatatatat     40980
     attgacaaaa tcgaatttat tccaatcact caatctgtat tagattatac agagaagcaa     41040
     aatatagaaa aaacacagaa aatagtgaat gatttatttg ttaattaaaa caaagttctt     41100
     actaaaatag atagtatggc tgttaaaaag taagcgagaa aggtcgtgaa ccctatgttt     41160
     acaagtggtg cgaaaaatag gttaaagcta gaaacgacag attatgaaat agatcaagtg     41220
     gctaatgcta tagaatgtat gtcagatgaa caatattcaa aagaaaaact gatgttatgg     41280
     gatcaagtaa aacatgcaaa ataccttagt cagtctcgaa atttgcttca aaatggtgat     41340
     tttgaagatg tatttcatgg atggactaca agtgatcata tgtacattca gtcggataat     41400
     tctactttta aaggaaatta tctgaatata tctggggcgc gagacatata cttaacgata     41460
     tttccaacat acatttacca aaaaattgat gaatcaaaat taaaaccgta tacacgttac     41520
     ctagtaaggg gatttgtagg aagtagtaaa gatgtagaac tagtggtttc acgctatgga     41580
     aaagaaatag atacagtcat gaatgtacca tttgatatcc cgtatgtatc ttctaggcct     41640
     gtttgtaatg aattatatga tggtgaacaa caaccgtatc caaatgggaa tgtaggatat     41700
     tataatccaa tgtcagcttt tacgccttct tacacatctg atgctcgtca gtgtatgcca     41760
     gggaaaaaac agatagtctg tcaagattct catcagttta agttccatat tgatacaggt     41820
     gaagtagatt ataatacaaa tatagggatt tgggtcatgt ttaaaatatc ttccccagat     41880
     ggatacgcat tattagataa tttagaagta attgaagaag ggccaataga tggggaagca     41940
     ctgtcacgcg tgaaacacat ggagaagaaa tggaacgatc aaatggaagc aaaacgttcg     42000
     gaaacacaac aagcatatga tgtagcgaaa caagccattg atgctttatt cacaaatgta     42060
     caagatgagg ctttacagtt tgatacgaca ctcgctcaaa ttcagtacgc tgagtatttg     42120
     gtacaatcga ttccatatgt gtacaatgat tggttgtcag atgttccagg tatgaattat     42180
     gacatctatg tagagttgga tgcacgagtg gcacaagcgc gttatttgta tgatacaaga     42240
     aatattatta aaaatggtga ttttacacaa ggggtaatgg ggtggcatgt aactggaaat     42300
     gcagacgtac aacaaataga tggtgtttct gtattggttc tatctaattg gagtgctggc     42360
     gtatctcaaa atgtccatct ccaacataat catgggtatg tcttacgtgt tattgccaaa     42420
     aaagaagggc ctggaaatgg gtatgtcacg cttatggatt gtgaggagaa tcaagaaaaa     42480
     ttgacgttta cgtcttgtga agaaggatat attacgaaaa cagtagatgt attcccagat     42540
     acagattgtg tacgaattga gataggcgaa accgaaggtt cgttttatat cgaaagcatt     42600
     gaattaattt gcatgaacga gtaattgatt aatattaata aaaataagat ttctagctaa     42660
     ccagttagaa atcttatttt ttgacttaaa accaattaca ataatagctt ttcaaatggg     42720
     acatatcata actttttata tttgaattcg tcacgaaaat taaaggaaag tggttattgt     42780
     gatttataat gaaaattgtg gggaaatgta caaattcgaa tctaatcatg gtggattaga     42840
     ttcacagtca tacgaatatt actaatttct tgtaatgtat ataaaagtat ggaaatcaaa     42900
     ttagtattag tagcaaaatc tttctttgta acacgggaaa ttattttaga gcaacaatga     42960
     aatgaactag gctatatgta aaaaataata cattaagggg gtattatcac acatccatca     43020
     acttaaggat ttgggttatt cttgaagtta aaagcacgtt actattctct tatgttaatg     43080
     agaaagggtg acgtgctttt tatgaatatg catcaaaaac aagagctgtc tttatttgcc     43140
     gaagagttat atcggtatat gtcccccgct acactgaatc aattagccat agaagcaggt     43200
     ggaatgaaat gaaaacgtaa gtgccatggg caccattttt tatctttgtg tgtatggtta     43260
     aatcaacaaa tcgctacaac ctctcttact caactttgta gtcaattaga aacttcaaca     43320
     ggaattttat taagtcctga gggagttaat cgacaattta actcggcttc tgcagccttc     43380
     tttcgaactg tatttactac acttctacaa gctaaaattg gaggatcatc tacaatttct     43440
     cattctcttt ctgcttactt tgagcggatt tgcatccttg attctacaat ctttcaagtt     43500
     ccagatcgat tcgcagctac ttatcctggt gctggaggct gtagtcatac agctggcgtg     43560
     aaaattcaat tagagtatga cttgttgagt ggagagtttt ctgatgtgaa aattgaacca     43620
     ggaaaacgaa gtgatcaggc atatggggcg actcgaatgg acatgacaca aaagaatgaa     43680
     ctatatattc gtgacttagg gtattttcgt ttacaagact ttaaatcgat ccaagataag     43740
     gaagggtatt atttatcgcg tcttaaatta ccaactaaaa tatatagaaa agaattcgaa     43800
     acagtggtat ttaaaacaaa acctgctcaa ttgagaccgg tatatataca aattcatttg     43860
     gaagacatca tgaaccaatt acaacctggc caagtgtatg aattacatga tgtatatgta     43920
     ggggttctgg tgcaaaaaag ctaaatgatt tgaaaatatt ctttcaaact tggccatact     43980
     ggtattacta cttaaaaaag gtgcgtgatc aggatggaaa aagaaaacat attcaaatgg     44040
     aaacattatc aagcagacat gattttgtgg actgtacgct ggtacctgcg gtataaccta     44100
     agctttcgtg atttggtgga aatgatggaa gaacgagggt tatctttgtc ccataccacc     44160
     attatgcgtt gggttcacca atatggaccc gaattaaatg agcggattcg aaaacatttg     44220
     aaacgaacga atgattcttg gagagtggat gaaacctata tcaaaatcaa aggtgaaaac     44280
     atgtacttat accgtgctgt tgattccgaa ggaaacacgc ttgattttta tttgagtaag     44340
     aaacgagatg cgaaggctgc caagtgcttt ttaaagaaag ccttggcttc ttttcatgtc     44400
     acaaaacctc gtgtaatcac tgttgatggt aataaagcct atcccgttgc gatacgagaa     44460
     ttaaaaaatg aaaaaagcat accatatggt atgccacttc gggttaaaaa atatttaaac     44520
     aacatgattg aacaagacca tcgatttata aaaaaacgaa ttcggaatat gcttggtttg     44580
     aaatcgatgc aaacagctgt aaaaatgatt gctggaatag aagccatgca tatggtcaaa     44640
     aaaggtcaac tcaaattaag ggcacaatct gcccaaaatc agaatagatg tattcatcag     44700
     ttatttggat taactgctta ggagtggatt ccagaaggaa tctatgcctt ttttgcgttt     44760
     gtccattatt tgcaccagaa cccatatgag caaatagaat acacaacgaa aaccatagaa     44820
     cttttcccag atacagatca agttcgtgtt gatataagcg aaacggaagg gatgtttaaa     44880
     gtagaaagtg tagagctaat atgtctggaa ggttgaaata aaaaataccc ttaaaaaagt     44940
     atagattaat tgatctgtac ttttttaatt aagtatagga gaacaagtat cctgatctga     45000
     ggatgagtaa acttcgcacg aaataccgtt tttacgaaca ataagatgta taaataaaaa     45060
     tctaatacag tatttaggga tttcgagcaa aattgtatga atctctgcat attgttatgt     45120
     gtctatataa ttcatatttt atataggaat cattaaatac tgaacgattc attgaaaaat     45180
     tttaaagtaa attacctttt aatatataga attttttctt atgttgatct aattacctcc     45240
     tcataatcat gattaaatta accaattcat gttagataac gaattttaaa cagttttcat     45300
     atattgattt tttgtatgaa tttatatata aaattgtttt attttacata catttatatg     45360
     tagtttttgc actaattttc atggtcttat acaaaattat cacttagtta taatttttat     45420
     ttgactaaat acactatacc attcagtttt gagtatattt tagtatttca taatttaatt     45480
     atgtaaataa gtttgtgtaa aaattgaatt tcatgcgaat ttatgtttgc tatttgtatt     45540
     agaataaaat gaaatacaaa tagcaaacaa tgtcaaaaac aaatgcaata tataatatac     45600
     ggttttaatg acaggatata ttttggattg aatatttatt cttcaccagg ctatctattt     45660
     ccattgagat aaatgtacta atacggtatc gtcccttata taatcaatac tattgctgtt     45720
     aaagtcatta tttgtaattt gagcttttaa tcatacaatc atttacgtgc cttatactaa     45780
     taaataatat cttttattaa ttaatcatgt ccaacaaaaa tttttgattt aaatttccgt     45840
     ttcgtttatt gattgtaagt atcgttccat tagtggtact agaactagcc acttctaaaa     45900
     catatcgggt gtctgtcata tttacaaaat aataggtacc cgacccagca ttttgaagaa     45960
     accagagatg atcatcgtta tttggaatag ggagtttaac agtaggtaca ctccaagtcc     46020
     atgctagtac taaggaagga tccctttgac ttttaatttg atacgcagat ttagtgctat     46080
     caaattcaaa aatccatttt tggttaatat cattattatt gttggtccat aatttcacaa     46140
     agtaatctga cgtataacca aaataatctt cagacatctg cagaacgcta ctattgttta     46200
     gggcagtctt aatcttatat acaccatcct gaaactcttg gtttacttta tttaagtaaa     46260
     atttttgctg tgcattatta ttttttctat tgactataac atttgtccca ttagtagtac     46320
     tagagttttc tatctctaat acaaattgag tgtctttcat atttgttaaa aaaatggaac     46380
     catctgctgt actttcaaga atccagaatt gtgaatcgtt ccaacgatta gtagaagcaa     46440
     aaactttatt tgatccagga gtagaatccc atgttagtac taaatagcga gctattaggt     46500
     tttgaatact gtaagcacgg gtagtttgat taaaaactaa aatccatttt tgattaataa     46560
     tattattata gtcccataac ttaacaggat aatcatgtgt attttcgtca taatattcag     46620
     taatttgaat agcacttcta ttatttacgg aagttatgat attaaatatg cctcttaggg     46680
     gttgaaaact ctcatgaatc aatggctgca taacttgaat tgcgtgtatt ttgacactat     46740
     agcttgcata atcttgaata ttaaaaaata ataagcgttc ccttgcaata tatgcagata     46800
     tctcaaaccc tataggaata gctttcataa aactacctgt ttgggcattt tggattgcaa     46860
     atacgatatt ataagtataa ttggtttgtg atgatgtttg gcgtccccaa aaaagccaag     46920
     cagattgctg ttgtacgtag aggtttgtaa aagtttctgt aattacagtg gttaattgtt     46980
     gtagcactga attagccaga ttaattccta ataaagattt aagctcttct atcaccttat     47040
     ttatcatgga ctgtacttga ttattagttt gtgataaagt acgtgttaca taattcacat     47100
     ttatagctct aggataaacg tgagtagcta ttcctaatcc cctttctaca tcaaatctta     47160
     atgtgtcctc cccgaagttg gatgtagtag gtactagtgc agattgaaat gcattagcta     47220
     actctatagc ttgaggtaaa tgaatgatat cttctatgtc tgcgatgtct aaagtattag     47280
     tgttgtatcc cggattattc acacgtagaa taataactct tgcacgtgat tgcccttgct     47340
     cccgtagatt ttggttaaat tctgattgag ccatgcactc gccccctgga tatcctctgt     47400
     aaatagatag aaattgacac tattatataa tatttaaata aatgaaaaat catgaataaa     47460
     gtaatctcct atttttgaag ataatcatgt agatttaacg ttggggtttt atgaattttt     47520
     aaaactaatc ctatgaaagt attctttgat ttctatggag tggtacaaga tttaaaagta     47580
     aaatagcgat acttaaacct ggataactct taaaatttat atatatgtga agttaaaggt     47640
     aacaaaacag cattcctcac gttggaatgc cgttcaagga aaaataaaag aaaaaaatat     47700
     atatgattcc gtgctcttct ccatttttat caataatagc tatcataagg ctctcttttt     47760
     cagcaaatta atctttgaaa tatgcttatt tttatttaag ctgattgtta ttgtggctac     47820
     gtccacacgt acaacctgta taataattat tgttatatcc atgctcatgc gaactacttg     47880
     aattatggcc ataattatta ttatatccat gctcatgcga actatttgaa ttatcgtcat     47940
     aattattgtt atatcctcgt tcacaagtag cacgtgtatt ttgtagatac gctgtatttt     48000
     catttattgt ttctacacta attccattca aatttgtata tacttcattt ccattatgct     48060
     ttctccagca taaaaataat tcatttttat cttcaacaac atgaaggtat ctaccctgtg     48120
     cttctaaagt ccctccagaa tatacataaa tacagtcccc tcttttcaaa ttcaaaaatg     48180
     aacgattatt catcagctat tctcctctct aattttcaga tcattgatcc attaaaaata     48240
     atatttcaca atacactaaa ttcgctttaa gaaaaatatt tattttttta gaatattacc     48300
     taaagaatgt ctcatgtata gaaatatttt aatcagttat gatataggga gtctgatcgt     48360
     acgtgctagt cttttatttt tcgaatcatt acaggttaca ttataaatat ctaatctaac     48420
     tgaaaactgt tctaaaatta aatatgtgct ctgagatgca ccaccggata aaaagatagg     48480
     tatactacca aaataatcac tataccagtt aggaaaatct ctataccttg tatgataatg     48540
     accacaaaaa atttctgcaa cgctgtattg ttgtagtgat ttttcgaatc ttgtattagg     48600
     tcctccagcc caaacatctg gtctgttaac atttaaaaca atgattttcc cgtttcttct     48660
     agctgtttct aattgatttt cgaaccaatt cagattttaa aatatatgat actcagtaag     48720
     actagtaata gtcgggccag tttgcttatt cattgtgggg aaactttgca attgtataga     48780
     gtatattgat ccgaaattta ctgtatacgc aaactttcta ggtgtcatgt aacagcaaaa     48840
     cctaaataat atccccctga ttctgttcta tagtcaaatt gagatgatgg tataccacgc     48900
     ccttgaacat gataaattaa attcacaaga gaactcttaa aacacccgtt atttacgaag     48960
     tcatcaaaat tattttcaat attatggttg cctaatcgat aataatagga tcttcttaat     49020
     gttctaaaaa aatcttttat cttactccat tcaggattaa acaaatcatc atgtccaaag     49080
     gaagtcatat ctccatttat cagcacagat gtatttggta cagtatccgt atacaaattt     49140
     atattattat attgttcacg tatcaatgct tcgaaacgtc tttttttcgc aaattgattt     49200
     tctggacgac ctgggcaggg gtattgcagt tttgacatga gctattgtcc tgacaatctg     49260
     tccaaggata ttgaggatca gaagtgatga ctaaagattg tatcaagtca agcggcgcag     49320
     caaaatttaa attttgttgt tggtttcgcc acattgtatg tccctcacct tatctattta     49380
     caaaagctat gttaatagat ataatttttc atatttcaat cattatagtt cggatcacaa     49440
     ttacaatttg ggtaattgtg atgaccacaa ttatcgtcgg ttgataattt ttctatgcta     49500
     ataaaattaa tattggtata aattttattc cctttttcat tgcgccaaca taaaaatgtc     49560
     tgattgttat cttcaactaa accaacatac attccttgtc cttctagctt tccagaagag     49620
     taaatttgaa gatattcata ctttctaaga tccaaaaata aatgttgtaa cataatcaca     49680
     cacccctttt ttaaattata aatacattta aacaataaag aatagaaatg ggactaaata     49740
     gaactcactt agaagccttt tcacgctcgt tccacaaatt taagataaaa ataataaatt     49800
     ggtgtaataa agaaaaagtg tgtatacagt ctaagaaatc ttaaattcaa aaatgataat     49860
     atttagaatg ccttgaaaag aagattaaca ggaacagttt taaagatatg ctatggggca     49920
     aaaatttatg cccatttaga ttaaagggaa ggatttccaa aaagcaatac atttagaaat     49980
     gcagttgccc acttgttatt atttttttta actaattaaa atcaatgcat agaatttgat     50040
     tatagaaaaa taataaaaaa atcttatata taaaggtggg aggcgcatgt ctttagatat     50100
     gaataaactt gagagaataa tgaatgaaaa tattgaaacc atccaaacaa ataacttaca     50160
     agaactaaaa tgtacattag taaaaaaatt tgatatttgt gcagatttaa tagaacattc     50220
     tttgcaattg aaaacaaaaa cgaatgtatt actatattat cttgagggcc ttacagatgg     50280
     tgttgcacta aaagggagtg tcgttacccc attattacaa gaagttaatg aagacatgca     50340
     agtatttaat tctaatatta ttactactca taccaaaata gtatatacat ggaatgaaat     50400
     taaagaggga ttgctcgcgg ggcaatgtgt attgtttatg gaaggagaac agaggtccct     50460
     tcttatcaac acaaaaggat gggcagaaag agcgattcag gaacctattt ctgaagttac     50520
     tattaaaggc tcacatgatg ggtttattga gaatgccact aaaaacatag gcctcattcg     50580
     aaggtatatt ccttctgcag agttgaaaat aaaaaaattg aagattggag agcgggccac     50640
     tactttagta tatttacttt acttaggtga tgtggcaaac gaagatgtag tacatgaagt     50700
     caagacaaga atttgtaaaa tcaaaacgga tacagtattg agtattggtg atttggactc     50760
     cctttccaca gtcttatata agtgagcgtc cagatgctat ttctaatcaa atccttgatg     50820
     gtaaagtggc agttttagtt gatagatccc ctagcgtaat gattgttcca atgaatttag     50880
     ttggtttttt cagacccctg atgattacaa tgtccattgg ttaattgcat cgtttttccg     50940
     cctattaaga tttttaggat ttattattgc tattttttta cccgcaatat atattacaat     51000
     ggtttcattt cactttgaaa ttattccttt agatctatac atttctattg caacatcaag     51060
     aattaaagtc cccttctcac ctttattgga agcttttatt atggaaatca cattagaaat     51120
     gcttcgtgaa actggaattc gtctccctca accgattggg caaacaattg gaattgttgg     51180
     aggtatcgta attgggcagg ctgctgttca agcaggactt gtgagtaatg ttatggttat     51240
     tatcgtatct attactgcta tttcatcatt tgtcgtttct aattatgatt tatcaagttg     51300
     tattcgtctt attcgttttc caatgatgtt atttgcctac ttttatggaa ttgtaggtat     51360
     tgttagtgga ttaatgctcc tatttgctca ttttgtcaca ataacctcat atggttcgcc     51420
     gtatgggcta ccaattgcac cttttcgttt acaggaacta aaagattctt ttgtaagatt     51480
     tcctaatcat ctgataactg atcgatctag tacaggacaa ccaaagcaaa caagaaaaca     51540
     gaaagggaat taaaaggagg tagtttctat gaggaaacat aactttcaat acttaacttc     51600
     atttgaatat attgttttta ttcattcgct acaacttgca tcaggtatgt taattatgcc     51660
     aagcccactt gccaatattg caggtacaga tggttggatt gctattattt ttggatggat     51720
     gataacttcg gtaatcggaa tagctataat attggtaatg caaaaaaatc ctaataaaaa     51780
     tttcccccag attctaacga gttattttgg taaatggctg ggaacattct ttattattat     51840
     atttggttct ggtgcaaata atggacaaac gcaaaaaaag gcatagattc cttctggaat     51900
     ccactcctaa gcagttaatc caaataactg atgaatacat ctattctgat tttgggcaga     51960
     ttgtgccctt aatttgagtt gacctttttt gaccatatgc atggcttcta ttccagcaat     52020
     catttttaca gctgtttgca tcgatttcaa accaagcata ttcagaattc gtttttttat     52080
     aaatcgatgg tcttgttcaa tcatgttgtt taaatatttt ttaacccgaa gtggcatacc     52140
     atatggtatg cttttttcat tttttaattc tcgtatcgca acgggatagg ctttattacc     52200
     atcaacagtg attacacgag gttttgtgac atgaaaagaa gccaaggctt tctttaaaaa     52260
     gcacttggca gccttcgcat ctcgtttctt actcaaataa aaatcaagcg tgtttccttc     52320
     ggaatcaaca gcacggtata agtacacctt tacgaactgc tagatttatt ctttgcttaa     52380
     aagaaacata accataaaaa gaaaattgta tgttaaggaa gttttttaca tgaaaaagat     52440
     tattcttttt atagtggttt tctttatcct aactagaaat tatttatcaa tatctatcta     52500
     ggaaggaatt tggaggtatt tgtaaaaaga aaaagaatgt ttataattgc tagataaaaa     52560
     aattgaaaat gtaggaggat gttaaaatgg aaaaaacaat gatggtaggt acaacaaata     52620
     tgatgatgtc tatggaaaaa atgatgtgtg aaatgaagtg tatgaagatg atgatgaaca     52680
     acatgatgca aatgaatgta aatatggata aagctatggt caatacaatg catgaatgtg     52740
     atgaaatgat gacttctact atgtctatga tgaaagctat gaaagagaaa tgctgttaaa     52800
     acatattggt atttcattcc gtatggcaca tagtcttcaa tatggttttt agctgtcata     52860
     tatgaatgta catttgcatt ttatttctta gaagacggtt caatattgac cgtctttttc     52920
     gtttgtagac ctcacctgag gtaaggcaac atcgccctca aactaagggg aacaaaatat     52980
     ataaaagtgt aaaatccctt tcatagtact tcaataaaaa gagctgtacg aaaaaaatgg     53040
     aacaatcaaa tagaagcgaa gaaacaaaaa agttgatccg tacagttata taataaacct     53100
     acaccttttt gaaattcagt cgagaaagtt ggggaattag gtataatcat gtcctcaact     53160
     ttctattatc tactactatt gtgcacatga agtgcaaaag gacgtgctat gtacatgatt     53220
     ttcttatatc ggtttgattt aaaggagaat ggaatcgatt ttgtgctaaa tgagcaaatc     53280
     gctgcagata tgcttccaca ctatgatgct ctgttgagac cattagtggc atcgttagct     53340
     gatacgttac aattgtatcg ttcattaagt acacatccca ccattttaac ggggaaaata     53400
     ctggataatg ggcaattaga agtgatgtta agtgaaggat taggacaata tatagatata     53460
     tatacaaaga atcaaattat ttttgaaaat ggaaaacgta ttgcggatat tttagtaaac     53520
     gtaatggact ctcatacgag taaaacattg aaaagaacgc attgatgaga tagaataata     53580
     gaaaagaagc ctatcccttg aaaaggtttg cttatatttc tgtataaaaa caaaatggta     53640
     tgtacttact ccattctttt gctagcaagt aactttattt ttaggaaatc atttcttgta     53700
     tagaaattta ctgataaaaa gaccgtagaa catacgaaaa gctccctgat ttgtataaca     53760
     aatcagggag taaaagatag tacagtatat cggttaagct aattataaca taactggatt     53820
     tattcggttt gttttttctg aatattcgat ttattttttg gtattagttc ttcaggttca     53880
     gatggcccta aagaatcatc taaccttttg aaaaagtgta cggtacactt tacttgtcta     53940
     aaatattgcg tatttccgac agttccatat tcgtaaactt cgcaatatct tcgatatcca     54000
     tgccattttt atgcatgcct cggataagtt ggatttttcc ttcttgaatg cctactactt     54060
     tccctttttc catcccttct tctataccaa cctcacgagc atgtgctaat tttgcttgtt     54120
     catcaaataa cactttttcc cgtgcttcat atgcgagacg gaaagagcta ctctgactca     54180
     tattttccca tttgtggatt gccttctgta acattggatc ttgtttcatg gctatatcct     54240
     ccaacgtgtg ggttaaatgc tcatcttcat gcgctggtag taaaagtaac caacgagcaa     54300
     attcattttc ccacggatta atcttttctt ctctccattg ctgtagcaat ttcggaattt     54360
     caatgaaatg gatttctaaa tcttcgagta acacttcctt gtgttgttga ctccaaaatt     54420
     gtccgactgt atgcatgtca tcatattgag gaaagagatc aaaatctaat agattaatcg     54480
     caatcgtttt tcgtaaagaa cgatagggca tcccttgctc caattgagat gtatacagtt     54540
     tactccaata atacagggaa cgttttacta tctcttgtgt atttcgtaac tgaatttcca     54600
     cgttcacctt ggtttcatct tgaagtgtag ctaatatatc tagtatggat aatttatctt     54660
     cttcatattc tttatggaga tgtgggtctt caatttttaa ggatacaatc ggtgtagata     54720
     aggattcatg caagattgca tttaaaaaag aaatcagtaa ttcctcttgt ccttgtacac     54780
     caaataattg cttaaaagca aaatcgactc gtaaattgac taaaggttga ttcatagagt     54840
     gagtcacctt tcttatttca tattctgtct tttttgttat tccccttttt cgggggaatg     54900
     ggcaaagaaa gtatatatct attgtagcgg aggaaggaga gaagaagcaa cccttgttgt     54960
     tatttttact gtgttttgtt tttataaaca ttatgatacg tgaaatttta tatatttctt     55020
     gtatatgcac ctatcctcac tgatttatct ccctttctac ctaaaatatt tactacccat     55080
     cttttcatta tcttatctcc ttgtatggta gctatttgcc ttccaagact caaacgtatt     55140
     cagaacctcc ttatctttcg ttagagagga atctgggcgt tcgtttttat ccctctcgac     55200
     taattaattg gatataataa ccattttagt ggtatttagg tgatcagggc attctccagt     55260
     gcttcctgaa ttacatgtga atcattaaat gagacgaaca gtaatacacc gctcggtgtt     55320
     tcaactcttc atacgtgtat aatctttgtt tctcaaataa tttcggatgt ttctgtctat     55380
     agtattggaa caattcttcc ccatttttcc gtatacgata ccgacgtgtt tctctaattg     55440
     tgcctgatat ttcttcagaa tcaaattgtc ctagaatctg taatgcttgt gaagagggaa     55500
     tttctggttc tgttgcaaag tttttggagt gaagttaaaa tatagagaaa atggggcgag     55560
     gagaaggatg catgggatat tttaaaggga aacaattcaa aaaagatatt attttggtag     55620
     ccgttggcta ttactgtcgt ttttctttaa gttatcgtga tgtgtctgag atcctaaaag     55680
     aacaaggagt ttctgtacat cccacaacca tcatgcgttg ggttcatgaa tatggcaatt     55740
     tgatttatca aatatggaag aagaaaaacc agtctgcaca tcatgtttgg catgtaggcc     55800
     tcaccataca tgcccatcaa cttaaggatg gatacaaaac caaatattgt tcatttgaac     55860
     taaaatctcc ccaaatggag ggatttatta aaaataagca cgcaaaataa accctaacgg     55920
     gtttcatttt tttcttatgc agctttcttt tgcttgctgc atccactata ctcatagata     55980
     acacccatga tatcaaagac tgttttcttc tcgtatcgat gagatttccg tccgttttgt     56040
     tgtagaaggt ggaacaggcg ggttagaagc tttgttatct cttgggtgtt ttgtatggat     56100
     tgatagagga gaaatagatg gtcctgaatc attccaattg ctttatattc acttaattct     56160
     tttttcttct tctgtaataa aagttgacgc attttaaaca tagtagaaga acataagaaa     56220
     atagcgatca gtttcccgta taaatggcac tctattcttt cttgtttgac agtgcgacaa     56280
     tgatctatat caaataatga tttccacgtt ttaaaaacaa tttctatctg ccagcgtaat     56340
     gtatacaatt catgtacttg ttccatcgga acccattccc aaggtgcatt tgtcacatac     56400
     acatttaatc ctgctactaa tttacttttc tctgaatagg ttctgtgttt cgacttttct     56460
     ttttctgcaa tttttttcag gcgtttttgt aattgtgctg ctgttaaacg atgaaaaacg     56520
     agacgtgaaa ataactgctg tttatctcca atataagctt gctggtattc tattgtttca     56580
     cctggttgga gttgattcaa aatttgtatg acattgattt gtatgtattc tgattgtttt     56640
     ttaatggcac catttttaaa atattccgga cttggatttt ttacatatac gttcgtattt     56700
     aactttaacc tcgaaatata atatgtcccc cgttgatcca tttgatctaa atcttctaat     56760
     gagaaatacc ctaaatcacg aatacataaa tcgcctggtc gtaacgtatc taaacattct     56820
     gttccaaatg ttttatcatt attttttcca gggcccactt gaaaattgaa aaattggcca     56880
     ctatgtaaat catattctaa ttgaattttg attccagctg tttgcgcaca accacctgaa     56940
     ccaggatata tatgttccaa agtatgaggt acctgaaaca tggtggcatc catgatacga     57000
     atgcgtttaa aatgggaaag aagttgatta gaaatgtaag tttgctcaca gattttttgt     57060
     tgtaacaaca aagaaaagac atgttttaaa aataacactg atttttcatt aaatcgttta     57120
     tttaagccct ccgggctaag tacagtacct gtaactgcgt gaagcctact acataatcgt     57180
     actaaaggat cactggccac tctttggcta atccaaatac aaatggtagc taaatctgat     57240
     cccgaaaatt tgcgttttct ctttacaaac ttcatctctc ttgccagttc ttccaaaaat     57300
     tcaggtgtga tatagcgctg taattcttct acaaatggtt gtaactcctc ttgaatcgag     57360
     agattcataa aaaaacgtca ccctttctca tttatattat gtaagaaaga ataacgtttt     57420
     ttggtacttg ggggtagtga aaattcttaa gttgatgggc atggcctcac cataccattt     57480
     cgggaaaatt gtacgtttag acacaattta gacacatttt aaccctgcaa aaaaatcctt     57540
     catgtaaaac aattacaaaa ttctacatga agaatggaag tactctatag tttccaatgt     57600
     actttatatt gcattctctt ttagcaaaaa aggtacatat cgttctaatt aacatacaaa     57660
     ctttaaaatt tttcaacaga atttattatc ttttttactt gtttgtatat atctcctcca     57720
     tattttgtag cattaatgca agtaacttgt ggaagtttag aagaaacttc ttttagttct     57780
     aaaatatcat tatcaatgaa tacaattttt tgtaatttaa tatgaaacaa cctagcaatc     57840
     tttttaattg aagttgattt gttgttagaa cttaattgtg gtaatacgaa gtatttttct     57900
     attccaagtt gctttagctt ggctaatccc ttagtatagt cagttttact agcaatagac     57960
     tgtatgatac ccaaattatg aagagactga atcgtttgca aggtattttc tcttaatgtt     58020
     atagtttctt cttttcttaa atctccattc catatagtat tatctaaatc ccatactaca     58080
     cattgaatgt ttttttggtt tttaataaat taattgttgt atgtatgtca tctgaataat     58140
     ttaaatcgat ttcatctgct aattctttta aatcatgatg aaggatatga cgtttttcat     58200
     catctgttcc ctcactaaaa tcatgcacat catttgtaac aaaatatatt tgatcgtaat     58260
     cacattgatt gttattgtta aatttatttg agaaatgttc atacatacta aagaaaatca     58320
     cagcatcccc catactgttt ttgtgtccaa agggtttctt tttttgtaat ccaaactcaa     58380
     tcaccatggt ttttaattgt ggatttgtta actttattgg tgttactttg ttttttatca     58440
     agtgctcaat atctttacat agagatgggt tttggatatt tgtatttaaa tgtatttgag     58500
     attcgatctt ttctaatgac tggtgatacg aattatcggt aggttcataa aagtatttaa     58560
     taaacgattt agcttgatcc aatgtctctt ttgtagttgt gagcttttgc tgtaggatac     58620
     ttgtatagtg acgattccat tctagtaaga cttgttctgg agcaaataaa ataattttat     58680
     tcgcagctat taattcctcc atttttcgaa aagtctgaac tccttgttcg cttccattta     58740
     aaaaattcaa ccaaatattc gtatctaaaa tgaatgcagt tggtttatcc catatatatt     58800
     tcatttcatt ctccttttta aaatacacca acgcttgttc tccatgaata agcgctggtg     58860
     tactttttgt aaattagaaa cggcaaaagg aattgtataa aatcgctact tgttaaggat     58920
     gaaaaacatt aacattagtt tattttagaa tattatagag atttagctat gtggagattg     58980
     tacagatttt aatgtagtta aaaaaggata catataatct atgagatgaa tgatacaatc     59040
     aaaataatac tcaaaacttt tcaatggaaa taaactcata tttcgtacag aatcagtgaa     59100
     gttactttga tgaaattcac gatgtttttt taaatccttg agtgaagagg tttctatatt     59160
     tttctccgta agcattgttt gaaatatgct taaatgatta ggttgtatta agtcttgtag     59220
     gtgtatcatt tgagcatcaa taagtgaatg gatatcaaaa aaatcctgcg atcttgctcg     59280
     tttaaatttt tctggtgtat cccctatatg aggtgaatgt gctagaattc ctatcatttt     59340
     tttacataat aaaataaaag gagaaggagc ttccaatgta tagttatgga ttttatattc     59400
     ctgtttttct ataattggtc cttcccattt aaagtcaatc tcaaaaaatt tctttttatt     59460
     tggtaacatt ataatgctat ctttgcatcg agcctctttt tgttccttgg tactaccagg     59520
     gtgattacat atttcttcat attcatgtaa atccatgagc tgaaaagtat atttataaag     59580
     aatttcttta gggtcgaata aattttcaga tgaaaattta ttatgtaaat ttagacttct     59640
     aatctctaat cttgagttta atactttata cttttctttt gaaaaagcct catcaaaatt     59700
     tttctccaat tcagtttcta atctcacata ttcatgaggt aatatggggg attctaaaga     59760
     taaatctaaa tctacagaaa ctctattatg aacattataa actaagttca aaacacttcc     59820
     cccagttaat accgttttat ctacaaaaat atcactagat aaaagggcac ataaagacaa     59880
     gttttgaaag tgttgaatct gtttttgtat gtttatttta tttttaacgc gggattttgg     59940
     gtgttgttca tccttatcta tttgattgag cccatgtgta taaataaaca tcggagattt     60000
     ttgattgttc atttttagac tcctactata aattttttaa tgcatcaatc aggtgttaaa     60060
     aatttatctt ttatacaaag gactctatta tattgctaca tttttcacac tagcaagtgc     60120
     cgcttgagat cctaacgcaa gtcccactgg ccatgttttg tgtacaacaa tttcagatcc     60180
     ttctgtgcga accgtttttc tagtgacaaa catattatcc cctacatttt ctggaataat     60240
     cccatgtaag gcatctgttc ctaatgatgc aaaccaaata tttgtagttg atttatcttt     60300
     tatacaatgt gttggttgaa aatcattgat ataaatcttc cagccatcaa aagaagattt     60360
     tccatctatt actggtggaa tttgatctct attataataa gcttttctaa tctgttcata     60420
     acctgattga ttggtgaaaa taacgccaga ttcgccttct ttcacacgaa tttgaccctt     60480
     agcacgatct aaatcctcta attttaaggt attaccattt agatctgtga cgttacttgg     60540
     tttgataagt tgtgtaaacc cgagaaaacc attggatcca gattctaatt gctcactaaa     60600
     tttatataat aactgacgtg tagctaaatg ctcttcgagt ttaaccaaat catttgtata     60660
     cgaatagata tcttgtcctt tatatgcaac taaaaaacta gtagctaatt cactcatagg     60720
     gaatgtgatt ggctcatctg ggattgttgt attgtctggg attggatctc caaacccaat     60780
     aatagatgct ggggtcaatt caggtgttcg tacatatctt agactatctc cttcaacatg     60840
     atgaaatggg aatacttcta ggtgttgcaa gcgttttgga ctattttcta ataagccttt     60900
     tgttaattct aaaatagata aaaattgtgc ttgtgcattt aaagccatat tctatctctc     60960
     ctttatacat aataaatgta atactagttt tcaccttatg ctagagaaca ttaaaatatg     61020
     taaaatttaa tcgcttctct agttgataaa ctttttataa tgaaaggagt aatcagcaaa     61080
     aggttaggtt ctttttttgt gtacagaaaa ttgtatattt ctgtacactt tattttttag     61140
     taaaaaacac tacaattttt cctattatcg tgtccataaa cagtgtacaa ttatgtatgt     61200
     tcagatatct atctaaaatt aaattattga acagggagag actataaatt gaaaattggt     61260
     tatgttcgtg tatcaactgt agatcaaaat ttggatttac aaatagatgc tttaaaggcg     61320
     tatggatgtg atgaaatatt tgaagataag ttgagtggca tcgccggaaa aaggcccggc     61380
     cttgaaaaag ctcttcaata tgtgagacct ggtgattctc ttgtagtctg gcgacttgat     61440
     cgtttgggaa gaacgatgca tcatcttatc caaattgtaa atgaattaaa tgaacagggt     61500
     gttagtttct atagtgtaca agaaaatatc acgatggatc gctctagcgc tacaggacaa     61560
     ttgatgtttc acttatttgc ttcttttgca gaatttgaaa gaaacctcat tcgtgaacgg     61620
     acagaagcgg gaagaattgc tgcaagggct cggggacgtt ttggtggaag acctgaaaag     61680
     ttaggagaaa aagaacaaca aatgatacaa acactcgtgt ctaagaaaac cccaatcaaa     61740
     gatattgcgc aaatattaaa aatttctcgt acaacggtgt atcgttattt acaaaagtag     61800
     gaggatgttc agatggcgac gagagaagtt ctgactcaaa cgcaacgaga atacttttat     61860
     aaattatcag accaggtgag tgaacgagag cggatacgat actatacatt atctgaagaa     61920
     gatatacaaa tcatccgtca acaacgtgga gcaacgaatc aattaggttt tgcgtttcaa     61980
     ctggcgtatt tacgattccc tgggcgccca ttcgcttctg gagaaaaaat acccgatttc     62040
     cttgtatcat tgcttgcaaa aagattagga atcgttcctg cagctataca taattatgcg     62100
     aaaattcgcg atacaacaag gagagaacac atcagcaaaa ttcgaaaaca ttttggattc     62160
     cgttctttta ccttacgaga atatcgagaa ttagcaaatt ggcttcttcc aactgctatg     62220
     ggaaccgaga aaggtctagt cttagttgat cttttgatac aagaaatgcg aaaaagaaaa     62280
     atcattcttc ctgccatgta tgccgtagaa catttagttt gggcggtatg tgaacgtgca     62340
     gaaaggcgaa cgtttaaaaa attaacaaaa gcgttatctc cacaacaact tttacaatta     62400
     gaccagctat taacaaagtc tgcagataaa catattacga atttatcctg gttacgaaaa     62460
     ccacctggga cggtttctct taaaaatttt cataaaatat tagatcgcgt tcaatttatt     62520
     caaaggctcg cattaccatt agaaaacgga caagagattc accaaaatag attactacaa     62580
     ttagctaggg aaggctctcg atattccacc caacatttgt ctcgattcca ttccatgaaa     62640
     cggtatgcaa ctttaatggc atttttaatt catatttatg cttttttaat cgaccaaggt     62700
     ttatatgtaa atgaaaaatt acttgggcgc atgtttaaaa gaggagaaaa aatacataac     62760
     gattcgtttc aaaatgacgg aaaattaatt aatgagaaaa tccgtttatt tgcaaagctt     62820
     gggaaagttt taattgaagc aaaagaaagg gaacaagatc cttttgtatc tttacaagct     62880
     gttataccat gggaccaatt tgtttattcg gtagaacaag cggaagcgtt ggcgaggcct     62940
     gcagaattcg attatttaga attactggat acctattatg gacaatttcg caagtttgcc     63000
     ccccgacttt tacagattta tacgtttcaa tcttctggta tcacccaaac attatgtgaa     63060
     gcacttgaaa tcttaaagga actgaataca tctaaaaaaa gaaaagttcc tgaatttgct     63120
     cccatggatt ttataaaatc aaaatggttg aaacatgttt taaaagaaga tggcattgac     63180
     cgtcattact atgaatttag tgtatggaca gaattatgta atcaccttcg ttcgggagat     63240
     atatgggtac caggaagcaa acaatacaaa aactttgatg agtacttatt accagtacaa     63300
     acctgggaag aaatcaaaag aaaacaacaa attccattgt ctattgctac aaatgtagat     63360
     gaatatttac aaaatcgatg cggattgatg caagaacaat taacaatggt aaatcaactc     63420
     attcgaaacc aagaattatc ggatgtttct gtttatggcg gtcacatcca aattccatct     63480
     ttaaaaaagg atgttccaga cgatgtggcg gatattacaa gggctattta tgatgtatta     63540
     ccacgtatta aattaacaga actattagta gaagtagact cttggacccg ttttagtcaa     63600
     cagtttgtac atcttcatac aaaaacaggg ccaaaagatg aaactgcatt atttgcggcg     63660
     attttagccg aggggattaa tcttggatta agtaaaatgg ctgatgcatg tcctactgtt     63720
     acctatacac aacttgcttg gatagtagat tggtatatca gtgatgaaaa ttatacaaaa     63780
     gctctgggag tcttatcaaa ttttcaacgg caaaataggc atgctgccca ttggggcaat     63840
     ggaaccactt cttcttcaga tggacaatat tttaggtcaa gtggtgcttc tagtccatta     63900
     gctcaagtga atgccaaaca tggaagagat cctggcctaa acttctatac tcatatttca     63960
     gaccaatacg atccttttta tgctcaagtc attagttctt ctgaggaagc gcctcatatt     64020
     atagacggat tattatacca tgaagccgat actagaattg aagaacatta tacggatgct     64080
     gctggatttg tagatcatgt atttgctatg tgtcatatgt tagggtttcg attctctccg     64140
     agaattaaaa gtatagataa gacgaaaatt tatacaatcg acaagcctac ctattatcca     64200
     gagctaaact ttatgattgg cggcaccata caaatgaaac atatacgaga caactgggat     64260
     gcattattga gattaatcag ttctgtgcaa aatggaacgg ttactgcatc gcttatttta     64320
     aaaaagttag catcttatcc acggcaaaat agtttagcgg tagcattacg agaaattgga     64380
     cgtatagaaa gaacattata tacattagaa tggctgcaag accctgcact gagaaggcga     64440
     gttcaagtcg gactcaataa aggagaagcg aaacattcgc ttgcacgagc cgtgtgtttt     64500
     catcgattag gagaaatacg tgatcgttct tatgaagatc aattgcatcg agtgaatggt     64560
     ctgcagttat taatttctgt aattgtcatt tggaatacag tgtatatcga aaaggcgatt     64620
     gaattattac gatctcaagg aatggaaatt ccagaagaat atgtgcaaca catttctcca     64680
     ttaggttggg aacatattgc attaacaggt gattatatct ggaatgtaca gaaaaaaaca     64740
     tcgattcatc atttaagacc tttgcgaaca aaatatgtaa gaaatagata ctaacaccca     64800
     ttaccgattc cctatgtaaa tacggaatcg gtaaaatgtg tctaaattgt gtctaaacgt     64860
     acaattttcc cgaaatggta tggtgaggcc catgcccatc aacttaagga tggatacaaa     64920
     accaaatatt gttcatttga actaaaatct ccccaaatgg agggatttat taaaaataag     64980
     cacgcaaaat aaaccctaac gggtttcatt tttttcttat gcagctttct tttgcttgct     65040
     gcatccacta tactcataga taacacccat gatatcaaag actgttttct tctcgtatcg     65100
     atgagatttc cgtccgtttt gttgtagaag gtggaacagg cgggttagaa gctttgttat     65160
     ctcttgggtg ttttgtatgg attgatagag gagaaataga tggtcctgaa tcattccaat     65220
     tgctttatat tcacttaatt cttttttctt cttctgtaat aaaagttgac gcattttaaa     65280
     catagtagaa gaacataaga aaatagcgat cagtttcccg tataaatggc actctattct     65340
     ttcttgtttg acagtgcgac aatgatctat atcaaataat gatttccacg ttttaaaaac     65400
     aatttctatc tgccagcgta atgtatacaa ttcatgtact tgttccatcg gaacccattc     65460
     ccaaggtgca tttgtcacat acacatttaa tcctgctact aatttacttt tctctgaata     65520
     ggttctgtgt ttcgactttt ctttttctgc aatttttttc aggcgttttt gtaattgtgc     65580
     tgctgttaaa cgatgaaaaa cgagacgtga aaataactgc tgtttatctc caatataagc     65640
     ttgctggtat tctattgttt cacctggttg gagttgattc aaaatttgta tgacattgat     65700
     ttgtatgtat tctgattgtt ttttaatggc accattttta aaatattccg gacttggatt     65760
     ttttacatat acgttcgtat ttaactttaa cctcgaaata taatatgtcc cccgttgatc     65820
     catttgatct aaatcttcta atgagaaata ccctaaatca cgaatacata aatcgcctgg     65880
     tcgtaacgta tctaaacatt ctgttccaaa tgttttatca ttattttttc cagggcccac     65940
     ttgaaaattg aaaaattggc cactatgtaa atcatattct aattgaattt tgattccagc     66000
     tgtttgcgca caaccacctg aaccaggata tatatgttcc aaagtatgag gtacctgaaa     66060
     catggtggca tccatgatac gaatgcgttt aaaatgggaa agaagttgat tagaaatgta     66120
     agtttgctca cagatttttt gttgtaacaa caaagaaaag acatgtttta aaaataacac     66180
     tgatttttca ttaaatcgtt tatttaagcc ctccgggcta agtacagtac ctgtaactgc     66240
     gtgaagccta ctacataatc gtactaaagg atcactggcc actctttggc taatccaaat     66300
     acaaatggta gctaaatctg atcccgaaaa tttgcgtttt ctctttacaa acttcatctc     66360
     tcttgccagt tcttccaaaa attcaggtgt gatatagcgc tgtaattctt ctacaaatgg     66420
     ttgtaactcc tcttgaatcg agagattcat aaaaaaacgt caccctttct catttatatt     66480
     atgtaagaaa gaataacgtt ttttggtact tgggggtagt gaaaattctt aagttgatgg     66540
     gcatgtatgg tgaggccatg tagatgagac gtacatcaaa gtgaaagggg agtggtctta     66600
     tctgtatcgt gcgattgata gtgatggata tacacttgat tttcaacttc gaaaaacacg     66660
     agatcatcaa gcagcatatg cctttataaa aaggttgacg aaacaatttg gagaaccaac     66720
     ggttcttaca acagatcaag ctcctgcact gctttgtgcg ttcaaaaaac tgaaaaataa     66780
     tggcttttat gtgcatacaa cacattgtac ggttaagcac cttaataacc tgattgaaca     66840
     agatcatcga catgtcaaac gacgttttgc caaatcttct ggattccaaa atatccgtca     66900
     tgcttcacgt acattgaaag gaatcaaaac gattcatgcg atatacaaac aaaagagaag     66960
     tcaaattcca gacttctctt tttcgacgta caaggaatta caggagttat tcagaaccgc     67020
     ttaaactata actatatttt gtaaacaagt ttgtgttttt tcaaactttg caacacacct     67080
     gtatagaatc tcctttttaa cacagtccta tttctaattt caatacttgg ttattatttt     67140
     accaattttt attaaaatct tctactttac taattattaa ttcttgataa cctatattct     67200
     aattctatat ttacccttaa cagtgcaatt ttttcgtttg ggggatactt caaaatgtta     67260
     agttgatggg catgtatggt gacccctata tagaaagaac agcgaagaca tttgcatccc     67320
     tctcgatttc ctaaacaggt cttgcaaaat ttggcgaaga cgtaatacct gttaagggga     67380
     tttccttgat agtttggggt tactattaca catctcaaac agggtatatc tatgccataa     67440
     tttttaaaca aacgtttgat tcggcattat tcgcacaaaa acagaaggat tcgctattta     67500
     tagcgaataa aaacaacata aaataataga gtttcaaaaa aaaatagccc tccaccagac     67560
     cttttttggt cagatggagg gctatttttt tcatgttttg acaagctgcg gtgagataag     67620
     cctgcatttg gacagacttc agccctcgaa atcgagcata tcggatagcc atgtagttct     67680
     ttggcgtctg caaagcttcg ctctatagtt gaacagcgta ctttgtaaaa ctttttccct     67740
     gtaactgtta gtttgttttt tctagcgata tccttatatt tctcccatat atgatgagtg     67800
     ataacttttt gtttttgttt ctttgaaaaa catacctcac gtagcggaca aacagcgcag     67860
     tcttctggct tcgatttata tttacgatat ccttcacgat ccgttgtcgc atactctaaa     67920
     atacacccca tcggacaaac gaatgcattc atttcttcta catatttaaa ttggcttttt     67980
     ggtacatctt tatttctttt tccaaatcgg cgatacccca tcaccataaa tatatttctc     68040
     tccgataatt tcttacagat atagctcgta aaatagcctg catcaagagt tacagcttct     68100
     actttgaacc cgaatttatc aatttgagct tggaggcgtg ctaaatatgg ctcggaatct     68160
     gccatatttc cagccgttac ataggtatct gtaataatat tgtacttcgc atcagtcgta     68220
     cgatggtcta agaaatgaaa accgttcggt tttccatctc tcattaaaaa tccactatct     68280
     ggatccgtgg tacttatacg agtttttttg gtaggggtat cactttcctc tctaggtttt     68340
     aattcttttt tccatgtacc ttacgatctt cgattaccgc agcttctagc tcatctatat     68400
     aaaactttgc tttttctttt ttatatttat gtacaaattt attcttattg gcattggcct     68460
     taatgtgcgt agaatctgtc attagcgcac gtcctcccac catccggtgc tctgtcgctt     68520
     gcctcacgat ctcatcaaaa atttcttcga aaatatttgt atgaataaag cgggtacggc     68580
     gattccaact gattgtagaa tgatctggaa tagtatctga tagagaaaac cctaaaaacc     68640
     aacggtaggc gatattcgtt ttaatctctt tttccaattg acgctccgaa cgaataccgt     68700
     aaaaatatcc aataaacatc attttaaata aaacgatagg atggattgac ggacgtccat     68760
     tgttttcaca gtaataaggg cgtaatttct cttcaataaa atcaaaacta attgtcgctt     68820
     caatcgcacg aaggaaatga tcttgtggaa ccagctcttc tacagaaaca gatacacgtt     68880
     catcacgatg attttttaaa gcacccatca taaaaactct ctccttttcc tctttttatc     68940
     agtgttgaca cataaaaaga ggttcagaca caaaaacagg ctgtagagaa gactttctcc     69000
     acagcattag aaggattgga ctgtgtctag gaatccgtcg tcctcttttg atattttaat     69060
     acctttgcac caaatccttt ttttacttag ggatagtaaa aaatattaat tgatgggcat     69120
     gtatgatgag gcctgttaga aaactttgca ccagaacttt aatttctaat tgttccggta     69180
     tcttttattt tgacttgagt attcacgcag attttagctt ttgataaagt ctgcaaccaa     69240
     tcttctttta cttttttcca ttctttatac tgaaaagctc tagcatatac agataaacca     69300
     attggatcaa ttttatttct ctgcatgtcc tgtaacatac tttgtaattt ttcattgatc     69360
     tcttcctgta tttcatgttc caatttattt atatgtttgc tgctatataa acgattttta     69420
     gttatgtttc cattggtttt ttcaattaaa gatacattca tgctcatatt tatattaaat     69480
     ataaatttac ctttctggaa atcaacattt atttttctct ttgcatcttg tactaaaaca     69540
     gacgtatttg gtttttgaat agattttttg ggagaaagaa caacatgtaa aattatccgc     69600
     cctttacttt ttgatttatt aataagattg aaaaatttca catcattttt agagattttg     69660
     gttaagtact ttcctttagg atctaaaaag gcaattccta ctgtatcaat ttcattattt     69720
     attttcttaa ttattggaac tgtttgtgtc attccctttt cattcttttc tctcatcaat     69780
     tgttgaatag tggaagaaac agactgatta ttttgtatag aggcttcgat tacaccgctt     69840
     atataagacg agagcgctgg tttatctggt ctatgaattt ttaatatgct tttaggacta     69900
     ccatcaacaa ttacaacttt agcattgata gtcgcgtaag ggtcccgata agaggaatcg     69960
     agtgcctgta tccagttttc ttcttgtgca aattttttcc cgattaaaat cacttcactt     70020
     tttgatgaag ttacaaaacc tattaatttc gtatccattt tgctaaatcc ttcatatatg     70080
     gtggatgcct gaacccaatg ttctacggta ctcttttgct tttcatgatg aaagagtggt     70140
     atgctcgttc ctacttgaat ttctccatta ggtgttctat ctaaggcaat taataggatt     70200
     aaagaggctt gttcaagggg gattctttga ctacaaccaa ttaaatacat acaactaatt     70260
     acaatcccta tccattttcg aatcatagtt gcttcctcct agttagccaa gtaaaaagga     70320
     tactgtaaat aaaaaggaac actggaaata aaacaaagaa aatgatgtta aatatatcca     70380
     taaggaaata tataaacaca atttgattta aatttgggtt aaagaatgta aatactccaa     70440
     caattaataa aatagagctg acaataatcc aattacgtga aattctacta catatagttg     70500
     tcatcgaatg taaactaaaa aataaatacg gatagattgt agtggaaaat acaattaaat     70560
     agtaagcaat gtatataatt tctaaacgtt ctatgaaaga aaagcgaatc ccctttaata     70620
     ggtgaaatac gggccaaatt acatccttta taccttcagg actaaaatat atataagtaa     70680
     gaatagtagc gtatatatag aaaaacatgg ttcctgtatt cgctatcagt attcctttta     70740
     tggctttctc ttttttttgt aaaaacggat agataaaata ggcaatttct aagcccgcgt     70800
     atggggtaat tgtttctttt gttgccctca caataggata gatgccatct ttcaaaatgg     70860
     gcagtagatg taatggatta taattacttt ttaatgcaaa aaggagaagt atcggcatcc     70920
     aagcagtgaa gaaaaaaaca agcatagaat aacttgtaag tgctcttatc ccactctgtg     70980
     ctaaaataat gaagggtagt agtagtaata tgacgatttg ataagtagga atagaaggga     71040
     aaatccatac tttcacaata tctgttgctt ttaataacgt attaaaagcc gcaaaaaata     71100
     aataaaaagc atataaaaaa agaaatatcg cccccagcca tttcccaaaa tacgtcgtta     71160
     aaacctgtgt gaaattcttg ttgggatttt tttgcaacat caatataatc aatactccaa     71220
     ttatagaagt tatgatccat cccagaatga tagaaatcca accgtctgta ccagcagtag     71280
     cggcaagcgg acttggcata attaacatac ctgaggccag ttgcagtgag tgaataaaaa     71340
     taataaattc taataaagtt aagtttcgaa agttaacctt ccccaggtga accaccttct     71400
     tttttctttt tttgtttcgg ttgtcctgta ctagagcgag tagtaagcat cgagttagga     71460
     aatcttacaa aagaatcttt taattcttgg aaacgaaaag gcgcgattgg taacccatat     71520
     ggtgaaccat aagaagttag tgacacaaaa tgagcaaata agagcatcaa cccgctaacg     71580
     atacctacaa ttccataaaa ataggcaaat aacatcattg gaaaacgaat cagacgaata     71640
     caactcgata aatcgtaatt agaaacaaca aacgatgaaa tggcagtaat agatacgata     71700
     ataaccataa cattacttac aagacctgct tgaacagctg cttgaccaat tacaatccct     71760
     ccaacaattc caattgtttg tccgatcggc tgagggagac gaatcccagc ttcgcgaagc     71820
     atttctaatg tgatttccat aataagcgct tctaataaag gagagaaagg aactttgatc     71880
     cttgatgttg cgatagaagt atataaatct aaaggaataa tttcaaagtg aaatgaaacc     71940
     attgcaatgt acattgcggg taaaaacata gctataataa atcctaaaaa tcgtaataaa     72000
     cgaaaaaagg atgcaatcat ccaatgtaca ttataatcat ctggcgtctg aaaaaatcca     72060
     attaaattta ttgggacaat cattgcacta ggagatctat caactaacac ggctactttt     72120
     ccatcaagaa tatgattaga aatggcatct gggcgttcac ttaagtaagc ctgtggaaaa     72180
     ggagttaaac tattatcttt tgtcaagtta gataattctc ctatgcctaa taccgtatca     72240
     attttaattt tactaattct tccctctacc tcttgaacaa cgtctgcatt cgccacatca     72300
     cctaagtaaa gtaaatatac aaaagtagta gccctttctc cgactgctaa tttcttgatt     72360
     tttaattcag tagaaggaat atatctacga atgagaccaa tatttttagc ggcattttca     72420
     ataaaaccgt catgagaccc tttaattgta acttctgaaa caggttcctg aatggatcgt     72480
     tctgcccatc cttttgtatt gatgaggagt gctttccttg ccccctccat aaatagcaca     72540
     cattgcccct cgagcaaccc tttttttatt tcattccatg tacatactgt ttttgtataa     72600
     gtagcaattg tatcagaatt gaatacttgt atgtcttccg ttacttcttg taacaatggc     72660
     gtaatgacac ttccctttaa tgtaacacca tctgtaagtc cttcaaagta atatagtaca     72720
     acattcgtct ttgtttttag ttgtaaagga tgttcaacca aatcagcaca aatatcaaag     72780
     atttgttcta atttattctt gagttcttgt aagttatttg tctggatagt ttcaacaatc     72840
     tcattcattg tagttttgat agttctttca attaaggaca tgggttcctc cttagtatgt     72900
     ataacagtcc gttttttttt attatttttc tataaatcag attctattca ttggatttaa     72960
     ttattttaag aggaaggtaa aagaaaataa taataaaaag aactccggat tatctgaagt     73020
     tctaatgtat atggaatcta cgaaggagtt tctatatatt ggtgttcgtc ccgacgatta     73080
     gttacgttta gaagtagaaa tgacatttgc tcgtttcaat gataaaaaag cctaaagata     73140
     acaacttttc tataggcttt ttatcggata atatattttt aagttactat aattgtttta     73200
     taggaaggta aaatattatt tctgaaaagt gcacattttg atatgttttt ttaaaggaaa     73260
     aagcatagat ccttaacctt aattagtaat agcgtatatt tttactgtaa atttactagt     73320
     tgcaccattc ggatttgcaa tataatattt agcatttgtg tatgcttcag tccttgattc     73380
     attcgagagt ttcttccaac gaaccgaatc cgttcctaag gaaacatcaa ccataatatt     73440
     gaatgaaata gcagaagcat tatctttttc tgtaggttca acaacccatt ttaatccctt     73500
     tgttcctata ggtaaatttg taatgttaaa gttttggctg gaacgatttt tttgcccgga     73560
     taatggaatt gattcagaag ttatttggga aattaatact tctttttcgt ttgatttaat     73620
     cccatttaat cgaataatac tatctattaa acctggtcca ggaaaatctg cggcgataat     73680
     accagcatga tttatcccac ttttttgtat gaaatcagtt cccattgtat tcattccacc     73740
     gtaaaatact tggccattca tatcacgagg gaaatctgtc cattcatttg ttgcattttt     73800
     ttgaatcagc ttttgattgc tatttgtatt tctactttct tttccacttg caataaacca     73860
     cggatagaaa ttattcaata atgctgatgc accacccgtc ccactaaaat ggttaagata     73920
     gattttccca ttgttggcgt tattatttgc ctgtaaaaga tggtttttca ccgcattcca     73980
     tttatcatac attccatttg ggccagtacc aacttcaaac ttatcttgag tatacaagga     74040
     atcacaattt ataccgtatt cttgggatgc tgtaaaattt tgcaataata caattttacc     74100
     gcggacatcc cctaatttcg gattatttct ttctgatgat gctacagaat ttgggtccaa     74160
     aaaatagtca gcattacgat ctttataatt tttaaatatt ttttcgaatg atagtgagcc     74220
     ggtttcaggg tcagtgtctt cttttaaacg cattaaaatc gtttctttcg gatgatctct     74280
     taaaaattga atagtctctt ttaatacatc ttcaaacatt gctttttgat aaacaattcc     74340
     atgatgcatt gcaaatgaat ccttaacacg tttaacacgc atgtctacat aacgaatacc     74400
     cgaatctaat tgctgggatc agttcatggt ttgattccta gtcagatttt catcaaaaac     74460
     acttactcca tgtaaagcca ttgaaccgtg agtccctgga atagatagtc cgcttatttt     74520
     ttttgaatcc tctaattcgg acatccatgt tgaattttga tagcctatat tggactcata     74580
     cgaataaccg aggtgactat cagcaaatgc cgtagtggtt gtacataagc ctactaatgt     74640
     tacacaagtc agaatgctac tttttaaaac ttttctcatt ctatctctcc ttttttaagt     74700
     tgaataatcc cataaaagaa atatcttatt ataaatattt atatcaccag aacgttgaga     74760
     acatctgttt aaattatatt tttataaggg gtgattcttt gaaattttga tagcctagag     74820
     tgtttaattg tatccctcat ggatattaaa acgtttattt ttatacaaac aaaacagaag     74880
     tcttaaacaa gactcctatt ttgtgacata atatgaaagg taaaatggtt cacaaattag     74940
     aaaagtttta ctgacatgcc aatatttaaa atacatttgc ttcataattt attataacag     75000
     taccatttat aaacagcgcc ttctggaaga atacttaaag tctgtttcca aatcaattaa     75060
     attcctagca aaacctattt ctcattaaag cttaagctaa ctacagtagc aatagattgt     75120
     gctgcatgtt cccagcttcc atcaattact tttccaatct gttgaccaag tgtgtttaaa     75180
     tcatttggat taacaggaat cccattatat gcagcaataa ttgataaaag aggagctgcg     75240
     aatggtgtaa aaccacctct atcaatatga tattgtggcg taccgattac ttctccatct     75300
     ttcactgtaa attcataata aacttgatca tctggacgaa aacttaaatg atgagaaatt     75360
     tgacccttaa catatttttt cccgccacct aaatctacta cttcaattgg ttttacattg     75420
     aattcatgtt caaatacttt tatttttttg acttcaggac catataaagc tgccttaact     75480
     gctgtttcta aattactctg tgaaaatggt tgaataccca tttgtgattc ttgttgttgg     75540
     ataggagctt ttgtttctgc agcaaacgcc gatgtagtag gcaatgcacc tgtagctaac     75600
     gtggctgcca tggccgctgt tacgatcatt ctttgtttct tcttcattac tttcatcccc     75660
     ttttcaatta tgatatatac cattttaaat gatctaattc agaacactta aatgaatgat     75720
     atctacatgt attatgatag cttctttcac tatttatctc aattttcaga tcaataagct     75780
     aatacccact tatatcaaag tatttattac ttaaaattct tatttattta ctttaaacgt     75840
     agtaagaccc tagaaaaaat actatgattg taattaaaag atagaataaa ggaagagaat     75900
     tgacatgatt tttctttttt tataatatgt acgcttctta tttaatgagt tttctagaaa     75960
     aaataatgtt atttgtactt ggtggtatgt aagtttctta agttgatggg tatggtgagg     76020
     ccttataaaa aaatagcgtt aacgagcatg tatggtgacc tcaagtagta aaaaaggcaa     76080
     gcctctacat gagtattttg ggttctgttg caaagttttt ggagtgaagt taaaatatag     76140
     agaaaatggg gcgaggagaa ggatgcatgg gatattttaa agggaaacaa ttcaaaaaag     76200
     atattatttt ggtagccgtt ggctattact gtcgtttttc tttaagttat cgtgatgtgt     76260
     ctgagatcct aaaagaacaa ggagtttctg tacatcccac aaccatcatg cgttgggttc     76320
     atgaatatgg caatttgatt tatcaaatat ggaagaagaa aaaccagtct gcacatcatg     76380
     tttggcatgt agatgagacg tacatcaaag tgaaagggga gtggtcttat ctgtatcgtg     76440
     cgattgatag taatggatat acacttgatt ttcaacttcg aaaaacacga gatcatcaag     76500
     cagcatatgc ctttataaaa aggttgacga aacaatttgg agaaccaacg gttcttacaa     76560
     cagatcaagc tcctgcactg ctttgtgcgt tcaaaaaact gaaaaataat ggcttttatg     76620
     tgcatataac acattgtacg gttaagcacc ttaataacct gattgaacaa gatcatcgac     76680
     atgtcaaacg acgttttgcc aaatcttctg gattccaaaa tatccgtcat gcttcacgta     76740
     cattgaaagg aatcgaaacg attcatgcga tatacaaaca aaagagaagt caaattccag     76800
     acttctcttt ttcgacgtac aaggaattac aggagttatt cagaaccgct taaactataa     76860
     ctatattttg taaacaagtc tgtgtttttt caaactttgc aacacacctc aaaaagctat     76920
     ctgtttatcc catcagtatg tgaaccgttt gtttcacttg tttatcgtcc actcgataaa     76980
     atacttctgt tcctttgcgt tcatgtgata acactttatg atttctcatt ttatgaaggt     77040
     gttgtgaaac cgtagattgt ggtaatttta aaattttttg taattcggta acatttaaag     77100
     catttttctc taataattga tgtacaattt gtagacggaa aggatgtgcc aataccctca     77160
     gtatttccgc acttcgctcg agttcataat taagatcgtt gagctccata taaaaaacat     77220
     ttgtcatctt ctttcgcctc attctttttt tagggtattt tctcatatac acgttttttc     77280
     gttagcaaag aatctaacat gttacactta caaactatct tgcaccgttc tctttctccc     77340
     tttatactga aacaagtata tatcacaata agaggtgact catgaacaaa tcagaattaa     77400
     tcaaacaagt cgcaatacaa tctgaactaa aaaagccaca agcaagtctt gcagtagatg     77460
     ccgtattaga gtccattcaa catgcactac aaaatggaga ccatgtacag ctatttggtt     77520
     tcggttcatt tgaagtaaaa gaacgtgctg cacgtgaagg acgcaatccg catactggtg     77580
     aggcacttac tattcctgcg ggaaaaacac ctgcctttaa agcaggaaaa gcattaaaag     77640
     aagctgtaaa cgctaaataa tatttcttta acagtagcat gaatccagta ggaatcatgc     77700
     tactgtttta ttttagaatc gaatcgtcga gattgcatgt ttatatacaa gctgttgctt     77760
     accttcaact tctattaaaa cagaataagt atcaaatcct cttattattc cttttacatg     77820
     caatcctttt aacagaatta aagtgatatc cttcctcttt tgaaacgcct cttgcaacaa     77880
     ttgttcctgc aaagatagca tgttcttgct tttatccttt tgaaatgctt gtaatttcac     77940
     ttccaacgag ttcgccccct attcttttca tactgttact ttgtattgtt ctaattcttc     78000
     cataagttgt ttcgcccctt ctgggctcaa cgtcagcttt ccatccgcta gtttgatatt     78060
     ctgggaagaa atctcccctg tgatgggaca agtaccatac gattgatatt tctgtagaat     78120
     aatcgtttcg ccttctacaa atatttctaa tggttctttt tcgtgaatat tgagtgtacg     78180
     cctcgtttcc cttggtatca caattcgacc aagctcatcg atttttcgta caataccggt     78240
     tgctttcata gaaatgccct ccttttgtac atataaaata tctcacatct tatgtgaccg     78300
     ttttcatttt ttaaaaactg catatactat aaaaagttga tatcaatctg tagaaatagc     78360
     gaggtttccc atgtctacat ctgatgttac ccacttacaa aaacaaattg aagaaaaaaa     78420
     gaaacaactg cgacagttgg taagagcata cggatataca gaccccctaa tttttgcctg     78480
     tagccaagaa ttagatcaac tcgtgtatcg ttttatgcgt gattattctc cacaaaaagt     78540
     tacatgtaaa aaacgattcc aattcatcaa tagaattgga atctcactat acatatgtcc     78600
     tctatatttt accataactg gagtctatgt ggactaaata aaccaacttc tgtataaaaa     78660
     catgcctctt ggtatatatt agggataaca attccaccct acaacattga ttgccactct     78720
     agaatgaagt ctcctaacat gattacaggc ggaattgtta cccagttctt caaaatttaa     78780
     aaatactact taacttacaa ttttctcttt tgatttgttt gacacctttt gtttcttttt     78840
     cattttcaca atatagattc caactaaaga aattaccatc cccattatct ccactattgt     78900
     aagcttctga gtaaagataa accatgcata gattgcagct acgattggtt gtaataaaac     78960
     taatattgaa gataatgcaa cattaacttt acccaaacaa aaactcaata gcccttgccc     79020
     taaaatttgc gaaaaaatag ctaaacctat taaaggcaac cattctgaag aactacttgg     79080
     gatataaact ccttcagtaa aaagcagtgc aatgaaaatc gttactgcac ttccaaaagc     79140
     actcacaaac ataataatac tagcacttac tctttctcgt actttatata ctgtcaataa     79200
     aaagaatgca tagaaaaaag cagttaaaaa agccaacata tctccaaata aattatctgt     79260
     tgttatgact gctttcccac taactaaaac aattacacca gatattgtaa taatagcccc     79320
     tatgaaaaat gtacgtgtta tcttttcttt aaaaataaaa aatgaaaacg gaataatgac     79380
     tagaggcacc aaattagcta ataaattagc atttgcaaca ctcgtataat aaaatgatac     79440
     gttccataaa attaaatccc ctgctaaaaa tacacctgct aaaagtatta ataaaatatc     79500
     tttctttgaa actttattaa gttctttcca tacaaatggt aataaaagag ggatagagag     79560
     caatacacga taaaagcctg tattaattgg tggtaactca cttagtttta caaaaatacc     79620
     acctgtagct aaaaaacaga tagctaaaaa tactaacagt atatatttcg tttcattatt     79680
     tcttatcatt ttcttctcct actgtaactc ctacataaaa ttgaacatat ctgatttatt     79740
     tgatactgtt ggttcatctt cttgcagtta ttactatatt ttttaagctc aattagcaaa     79800
     ttaaatccgt ttggtgatgt aacccagtag aaaggatttt ggaagaggaa caaatataat     79860
     attcgccttt tgctaagcct ggctactcaa tatatctagc ctcataggtt ataatatctc     79920
     tcctaaagtt ttcaagatgc taacatagta cttaaattga tttataagaa acttctcatt     79980
     atgaatcaag aatatgtgtt caaagttatg aaggtattac attttttcta ttcattttta     80040
     cagcttttca cttataactc cttacgtatc cgagataaac cttcttctaa agtagcccta     80100
     ggacaggcaa tattcattct cagaaatcct ttcccatttt caccaaacat agaaccttca     80160
     tttaaagcta atttagcttt ctggtacatc catttttcta tattttcttt attcatcctt     80220
     aatcctcgga aatctaacca aactaaatat gttccttcag gtttgattac cttcacttca     80280
     tttatatgct gcttaaaata atcaagtaaa aaatttaaat ttccctctaa ataaattaat     80340
     aattgattga gccattcttc accatgggta taggcagcct ctactgccgt tataccaaag     80400
     aaactttccg aatgtaacga aagcatcttt aacttttttt catacacttc ctttatatga     80460
     ggattttgaa tgattaggtt acatgttttt aaccctgcaa gattaaaggt cttactagta     80520
     gaaatacatg ttatactcgt acttttcatt ttttcagaaa tagatgaaaa tggtacatgt     80580
     ttattgcctt tatatattaa atcacagtga atctcatctg aaatcacaat tatattatgt     80640
     ttcgcacaca gtgctcctag tctctccaat tcttgttcat cccatactct cccaacagga     80700
     ttatgaggat tacataacaa cattactttc acacttgaat ctattttatt ttctaaatct     80760
     tttaaatcca tagtatagcg gccatcttct agaataagat tattcgttac taattctcta     80820
     ttttgttgaa gaactacatc atagaaagga tgatagacag gagattgaat catcacttta     80880
     tctcctggtt tagttaaaca agagaccaaa atacttaacg ctgttactac ccctggagaa     80940
     tgtgtgatcc actccttttg taccattgag ccatgccttc tcttcagcca atctattatc     81000
     gaactataat aggaatcagg tatgattgta taaccatata cgccatgtgt agctctattt     81060
     ataagtgcat ttactactgc tgggggtgac ataaaatcca tatcagccac ccacattggc     81120
     aaaatatctt ctgtttcaaa aagaattttg gactgatccc atttataaga tgctgtataa     81180
     agtctatcga tttgttgatc aaaatctaat ttcataaacg tcccctttta ttttctaatt     81240
     ttcagacatt taaaacgtaa gcatcttatt atcttgtaaa ctagcataag accaggaagt     81300
     caccgtcatg ccataagaaa cttttttagg ttgtttgtgt aggttaagat tagtcatacc     81360
     cttttcttta cgatattcct cattataaac tgttttataa tagcgatccc ctctatctgg     81420
     aaagatagtt agaatattcg tttcttctga acatctacta cttaaaaatc gtgaaactgc     81480
     atatgatgcc gctgagctat tacctgcaaa tagcttttca cacttagcta attctaaatt     81540
     agctgcataa cattcttcat cgtttaacca atgaacttca tcaattattg agaaatctac     81600
     attttttgga attacactat ttccatgtcc tccttgtaaa cgccctggaa tatctggttg     81660
     attaaaaata acacttccta ccgcatctac tgctacaaca cgtaagtcag gattcgcttt     81720
     ttttaaagct cgtgccgtgc cacaaagtga tcccccactt cctacagaag ctactaaaat     81780
     atctatatgt cctagctctt caagagcttc atccgccaat gactcatagg cattggggtt     81840
     atcagaattt tcatactgac gaggacagaa tgcttcttta ttctccttaa gaatttcttc     81900
     tagtctatca agacgagcac tttgccatcc taaatgcgtc atttctgtaa ctatttccaa     81960
     tttacaacca agtgatttta attttgcaag agtcatttga tccgtacgtt tgtccgttac     82020
     aatatgaacc ggatgcccta aataagttcc aaccattgca agtcccaatg ccatggtccc     82080
     cgaagaactt tcaataattg gagcaccatc ttttaaaact ccattctttt tggcctctaa     82140
     aatgactttc tttgcggcac gatccttcat cccaaaagga tttagcattt ctaattttgc     82200
     aaagacgttc cctctagctg acgaatctaa ttgaagttgt actaacggcg tgtttccaat     82260
     cgcatctact atgttttctc ttagcatcat tactacctct ttctatttta tactttctat     82320
     caaaactaca tgttaataat aagatcccta atacgatttc aataatcttc tttcttttcc     82380
     aatattactt ctaaaattcc tgataataag atgcatcctc cacctacaat ggaaatacag     82440
     tacaaggatg ggccaacagt tacaagcatt tctcacggct aaacagggaa tgttgataaa     82500
     ctacttcctt ttcacatctc ccaaagcatc cctcaatgct tttacaggaa ttaccgctgc     82560
     tgcgtaaatg gaaacggata ctaatcgttc ggaattattt aaatgaatct cccccgccga     82620
     tttctaaata catacgctcc aaatttttcc ctctcgagtt tcttcttaca gaaatttctc     82680
     caatatctcc agtctgtcta acatgtgtac caccgcatgg aatatgcata tcaccacaaa     82740
     tccaattgat tgcttctggt tcctcattta atgggatatt tttaatggga atattatctg     82800
     taacgattaa atttgcgaac tcttctactt tatctaaccc ttcacgatca agacgtttat     82860
     caggactata aaaatcaaat cgagccctat cttctgcaat atgacaacct ttcacataca     82920
     tctccccaaa aacttgaaat gtataataat aaactaaatg tgccgcagca tgcattctca     82980
     tcaacatgtg gcgtctttcc caattgattt ttgccttaac ttccattcct tcacgtagtc     83040
     cctttaccgg ctcttttaaa atatgtgcta cttctgaacc caccttaatg attggaaaat     83100
     tagaatgata aaacagattt cctcccgtct tttgtgtatc aattacctca tttccctcaa     83160
     tccatccttg atctccaatc tgtcctccac cttctggata aaaaacagtt tgattcaaaa     83220
     agattttatt atcttctatt tttgttataa tggcgttaca ttcctgaaga tatggatctt     83280
     ggagatataa ttttcgaacc attttacaca ccccatttac atttatgtat gctgcttacc     83340
     ttaatttctt tagatagtaa tttctctaat cgttgcttct ggaaacatca ttgatatacg     83400
     attttttgca tgctcaattt tcatatcatc attcgcatca aacaataaag aaagaatgga     83460
     accactatgg gctaccgata ttccatgtgc ccctaattca ggaaagatat tcataatatc     83520
     attgaattct tttttaaaat gtctacgttg attaaccttg gcacttattg tagtagcacg     83580
     ccccaacaat tcaatatctt tacttttaat cgcgcaagtc gctaagcggt aagcttccaa     83640
     gacttgtttc atctcctttg gtgtatacgg tacccgttta aaattaactg tatctaccgc     83700
     ttctccatta tcaacgataa ccaatcgcat tgacattaaa ggtccaatat cctcaagtaa     83760
     cctcccctta aaaaagtcat atactaccga tgattgatac attacaccat cagatggttc     83820
     aatagatgta caaatatttg atatttccca aggtccgata ggatagttac atagatttga     83880
     aatagcccga caaaccgcta taatgtcagc tgtactacta gccatccctt ttccttccat     83940
     taattccgac tcaattttaa ttgtaattcc tagttcctta tcgactatac ccaattttct     84000
     taatgagtct actaatattt cggcagcttt tgcagcttta tttttataac cagggattat     84060
     acttattttc cctcccctta caaatctggc ttcagcacta gcatatagag gtataggaaa     84120
     tgtgatcata aaattttgat cattaatgca accttgaaca agctcgccac acgtaccaca     84180
     agagattcca acacctgttg cagagatagc ttccttcatt atcgaatcat tttctctact     84240
     tacaatcatt tatatctcct ccttccatat ttagtataat aaaattggtt ggttacaaaa     84300
     acagccaatt ggttgttttt atatccagcc aattcgttat aattgaaata gttaaaaaat     84360
     agggaggcat ttttatggaa tggaaattag ataatgactg caaaatcccg atttatcagc     84420
     aagttattga ctttattgaa agacgtatta catacggaga gctccctcct ggtagcttac     84480
     tcccttcaga acgaaaatta gctacgcatt tacatgtaaa ccgaagtaca gtaacgattg     84540
     cttataacga acttcgcgct atggggattg tagaaagtac aaccggtaga ggtacacgtg     84600
     ttagtacaca tatgtggggc gtttctccta cattaacgcc gaactggaaa agtttcgtgg     84660
     agggtggtac tttttcgcca aacttaccgt tacttcgcca tattcgggca caagtacagc     84720
     aaaatgaaaa tatgattgat ttcgcaagcg gagagctcgg ttgtaatctc tttcctcatg     84780
     aacaactaca agccattcta cgtgaacagc cgttaacaca atcattaagt tatgatcacc     84840
     cgcaaggcta tcttccgcta aggcaaacgg tagtaaaata tatgaaggac tatctaaaag     84900
     tgaaagcgac cgaacaatct attatgatta catcaggcgc acaacaagca cttcacctta     84960
     tcgtacaatg cttattaaat ccaggtgatg ctgtcgcttt cgaaagccct tcccattgtt     85020
     attcattacc attattccaa tcagcaggta ttcgtatttt cccattacct gtcgatgagc     85080
     acggtattaa cccgaatgac gtgcaagaat tatatagaaa gcaccgtatt aaaatgatct     85140
     ttttaaatcc gaattttcaa aaccctactg gaacaatgtt acgtccaaac cgtagaaaaa     85200
     aactgttatc gctttgtgca gacttacgaa ttgcaatcgt tgaagatgat ccatccagtt     85260
     tacttacttt agaaaagaaa caaccttgcc ctactttaaa atccattgat gaaaacggaa     85320
     cagtgattta tatacattcc ctatcaaaga tgattgcacc cggtctacgt attggctggc     85380
     ttgtcgctcc gcagtctgta gtagaacgat tagcagatgc acgaaatcaa atggagttgg     85440
     gaatgagcat attcccacag tggcttatac aacaattttt tgaaacaata ccatttcagt     85500
     ctcatataga gcctttacgc aagcaactag gagaaaaaag agacattatc gtacgtgctc     85560
     tgaacgaaca actacaagat aaaatctctt tctcgaaccc aaacggcggt atgtacatat     85620
     gggggaaatt aaacaaacct attaatgaaa aacaacttat tatgcaaagc ttaaaaaacg     85680
     aaatcgcctt tatgccagga agtatcttcg gtgcaaaaaa tggttacatt cgtttatctt     85740
     atggtaaagt gaataggtat caaattgagg aaggaatttc tcgtttacgt gaggcgatta     85800
     ctatttgtga ggagtaagtt ggatatttcc actcactcct cacaatattg caagcattac     85860
     tattttcaca tctacatttt ttctcttata atccatttat ttcatcaaat gtatttttta     85920
     tactcttcac ctaaaacgaa ggttctggtg caaaaaagct aaatgatttg aaaatattct     85980
     ttcaaacttg gccatactgg tattactact taaaaaaggt gcgtgatcag gatggaaaaa     86040
     gaaaacatat tcaaatggaa acattatcaa gcagacatga ttttgtggac tgtacgctgg     86100
     tacctgcggt acaacctaag ctttcgtgat ttggtggaaa tgatggaaga acgagggtta     86160
     tctttgtccc ataccaccat tatgcgttgg gttcaccaat atggacccga attaaatgag     86220
     cggattcgaa aacatttgaa acgaacgaat gattcttgga gagtggaaga aacctatatc     86280
     aaaatcaaag gtgaaaacat gtacttatac cgtgctgttg attccgaagg aaacacgctt     86340
     gatttttatt tgagtaagaa acgagatgag aaggctgcca agtgcttttt aaagaaagcc     86400
     ttggcttctt ttcatgtcac aaaacctcgt gtaatcactg ttgatggtaa taaagcctat     86460
     cccgttgcga tacgagaatt aaaaaatgaa aaaagcatat catatggtat gccacttcgg     86520
     gttaaaaaat atttaaacaa catgattgaa caagaccatc gatttataaa aaaacgaatt     86580
     cggaatatgc ttggtttgaa atcgatgcaa acagctgtaa aaatgattgc tggaatagaa     86640
     gccatgcata tggtcaaaaa aggtcaactc aaattaaggg cacaatctgc ccaaaatcag     86700
     aatagatgta ttcatcagtt atttggatta actgcttagg agtggattcc agaaggaatc     86760
     tatgcctttt tttgcgtttg tccattattt gcaccagaac cttattttgt tgtcttatta     86820
     aatcttctga aatgcgttct gtggcagatc tgtcttctgt aggggcacga caacgattcc     86880
     ttctttttgg ggccactcaa aatagccaca acctatttat taatagactg tggctatttt     86940
     tgtctaattt gcagcgttta atctatgagg tgaaatagcc atatcaaatt ggatatcggg     87000
     tggttgccga ttatcgtcca atccatattt cccgaatcga ttgatatgaa aggtaaggta     87060
     tggactcaaa tcagatagta cttcttcgtc taattcattt ccttcctgga tgtattcatg     87120
     caggatacgg gtaagttgaa aaacgttata gaaaataaca caatttgcaa taagatgatt     87180
     gtattttata attttccgtt gtctttcccg atgattttct gcaataattc catctcctcc     87240
     gaagaataac cattttgtaa atccattaaa agattcgctt ttatttgtag ccgcttgaat     87300
     agtgcttctt aactcctcat ccgataaata tttcaataaa aataatgtgc ggattgcaca     87360
     acctaattca cggaatgctt gatataattt gtttttcttg ctatatccac taagtttatt     87420
     aagaatagtc gaaggatgaa tacgtcccgt tttaatagac atcactacac gtaacatatc     87480
     ctcataatgt ttttcgatta tgttccaatt caccgaagtt gtaaatagtt cattaatatg     87540
     ctgataattc gagttgttat gcggtcgtaa taattttaaa tttttccaat ttcgaatccg     87600
     gggcatcagt tggatcccta ataagtagga taacccaaat atcggtgcat tttgtccttg     87660
     cgtgtcagaa tgtaatgtat taggttgaat atcagattga tttttcatta gaatatccaa     87720
     aatataaacc ccttcccaga caccacaagg tataaagtga ctgaataagg caatataatt     87780
     atctgaaaca tggtaatatc caattccacc atacccaccg taacgaatat gattttcaga     87840
     taataagttt tgttcataga gatcccattt tgtaccatca gctgcagcac tgtttcctgt     87900
     tccccaatat tttggtaaat taaatttatt ataagcatta attaaccatt caatggcttt     87960
     ttggatattt tcttcagtga cgtgtcgttc attaatccaa gaaatttgcc ttcgatccac     88020
     tgtaccaagg gaacgtgcag cttgagtagg acctaaatta caaccataac aaaaagcagt     88080
     tgttaaatat ctttgagtgg gtttagtaat tttggcatca taaccagaaa taggaccaaa     88140
     aaatcttgtc cagtttaacc aatattctgt atcacttaat aaatctaaaa cattaatagg     88200
     taccattctt tcttcaattc gttttctaac agcctttaat aacggtgaaa tcttcttctt     88260
     ttttaatttt gtgataaaag gttctccgtt tcgaatggta acggctttat tttttggaaa     88320
     agaagtatcc acttttttcg caagtgattc aagcttatta cacacctgtg ttttaaatgc     88380
     ctcagctgtt gttagaaggc ctgcctgttc acaaaatata tgtaagtttt gttgatattc     88440
     atcccaggat attaattgct ctcgataatc agcatattgt tcgctacctt caatacataa     88500
     atctccggat ttcaattcat ttctaacttg ataaaataca caagcttcaa agtgtcttcg     88560
     attaattttg tctggatata catttcttct acgattggag ctaatccagc gccaccatcc     88620
     ttcaggaatc caggttaaat caacaagagg aactgattcc caatcatttt tattcattcc     88680
     attcttacgt gtatagattg ttgaaatcca ttcggatttt ttaagtttat tttttaatag     88740
     gaaagtaata gcttgttcta accctttact ttgtgtcgta gatttaaatc ttaatgattc     88800
     aagcatatta attaattaat taattaattc agatcgatta ctctttaaat atttccacat     88860
     aaaagaaaag tagttatttc cagtataagc taaatattcg tcacaattct ctaaaatctg     88920
     ttgaccgcga tttccaccaa ttaatgtttc caatgagtgt aatcgtgttt ctacatcaac     88980
     gtctaattga taagtggtga tggtatcacg taatgtagta atgagttcgt ctgtttgttt     89040
     ttctcgtttt tcttttaaaa tatggaaagc tctttccgct ttattttcag cttttgcaac     89100
     tcgtttgata tacatcgttc caatatcgtc aatcgttttg gcgtgttgaa catgcaataa     89160
     agatatagct agtgtatatc gtttatgggg ttcaagttct ttcatacgag ctgcatctaa     89220
     tgtttttgct tctgccgcta atcgttctac tttcgcagga ggaatatgta agttttgaaa     89280
     aaaattactt cccacctgtc ggtcactaat ccaatttttt cttgcaatcc atgtcctaat     89340
     ttgttctagt gtaggacgac cggggtctcg ttttatcgca tgccaatcag aataagtggc     89400
     cccatcaatc tgttgaaata gtgcatctac ttttgatttt tcttcattac ttaatgaatc     89460
     tgcaacttgc ttatacaaag tacgataagc tgtactatga atatgatcta ccgattttac     89520
     taatgtctga aatgcaggca attcataact atgtttaact aattcatcaa ttgcaacatt     89580
     tacaatatca ctttttgcgt ctttttctaa tactgcattt tccattgccg atagcataat     89640
     ttgacgagct tgattatcaa atatcttcgc ttgtcggtaa ttacgaatca tagtaatttg     89700
     ccgtttccca gtacctgtcc gatgataaga atcccatttt tcatcacccg aaaggctaat     89760
     gttagatatt ttagcgatat gcttaataat aacaagtgga acatctgtaa tgggaacaaa     89820
     atagtttaaa cactgaaaaa cttttagcat tattaaaaag tttagctgag aaaatggatt     89880
     acgagaatgc attttagtcc aatttaattc ttttaatata ggagaaaata gcttatctag     89940
     ctctttcggt gtaggattac tctttaatct tggataagct gtttcttgaa cagtcagcat     90000
     aagggggctc ctctctattc atagtagggt gtttttgccc attccctcga gacaaaatgt     90060
     ttatcccaaa tcgtgtatct tcctatataa agaggatcta gatacacttg taatttcaca     90120
     aatttgtttt actgtcatat ttccttcttc gtaaagcttc atcgcataat tcattcctgc     90180
     atgtttctca tgatattttt ttactcgccc ttgatatttc ccctcttttt tagcaagggt     90240
     aattccttca cgctgacgca ttcgaattaa gtccctttct aattgattta ctcctcccat     90300
     tactgtcatt aagaaatgac tatatggatt ttcttctgat aagtctaacc aagtatcttt     90360
     taatgatttt aaattggctt gtttattttt tatgtaatca actaattcaa ataaatccct     90420
     tgtacttcga gtaattcgtg ttaaatctgt cacataaatg atgtctcctt ctttaagatt     90480
     acctaacata ttttgaagtt caggtctatc ttgggtggca cctgatactt tttcttgata     90540
     tatgatatcc actccgattt cttccatctg ttgtaattgc ctctttgggt tttgatctac     90600
     agaacttact cgtacataac ctatctttct catatgtcac tctccttttt gaaacaagtc     90660
     atatgggaca ctccgagata ccattatacc agacttataa gaacatccca atagagtcta     90720
     ctctattggg atgtttctgt gattatttaa tgaaaagaga tagagtgaaa atcatgtacg     90780
     aaatacatgt aagtaaaacc agaaagaata taagcttcgt atgagataca tatcgttcta     90840
     ttctttttct catctcaatt agttttattt ttgcaacttg gaagaatcaa ttagaatttg     90900
     tcccttccaa gatccggata cctttccaat tttatttata tttacatcta atgtaagtgg     90960
     ctgcttaaag gaatcttttc cctcaggacc ttccacaaat gtaaggacac tttctggtcg     91020
     atctttatca cgaataccta catgatctaa ttcttgccct gccgctttta gcttgaatgg     91080
     taagccattt tctccttgaa taaatggtaa ttgtgagaag ctaccatctt ttccgtagta     91140
     ctctgggttt tcctcttgtt gtccattttc cttgccttca cttttaagat ttaatcccgt     91200
     tgtatcaaat tcatacggta ctaaacttcc atctgctttt tcaattttat aatgaacaga     91260
     tatacgtgaa tctgccacat ataattcttt gaaatgtacc gtaacacctt gatctgtgat     91320
     tttctcatca atcggaatgt attggccatt tttcatcata tcttgtgtga caccattttc     91380
     atcttgcata ccttcattta caaccttatc atttgaaact tcattcgaaa aataggaagc     91440
     aacattcgtc gctgccactc gtacttgtgg aatcatagct gttgtgaaaa gtcctgctac     91500
     agctaccacc gcatacataa agcgttttga ttttttatcc atattcgtaa acaatccctt     91560
     cttctgttca gttttttcat ttatataaga aacattttct agttttgtgc gactttcaaa     91620
     tgttttccac gcttgatcaa tatcaatgtt gatatcttgt gatgagtgta tagtttcatc     91680
     ctctaacatt acatgttccc attgatttaa tttactaatt tcaagtaatg tattttggca     91740
     tacttcacat gtatctagat gctttgtaaa ttcttttctt ttatcatgag gaagctcccc     91800
     atctataaac gcttgaacaa accctttatc ataacaattc atttgttatg cctcctctac     91860
     ttgtttatac attttacgaa acttctgttt ggctcggacc aatagtgttc caatagaaga     91920
     tatgtcaata tgaagtacgt ctgcgatttc tttgtattga aaaccagaaa atttcattaa     91980
     caatatggtt cgatctcgtt cattcatatt actaagtacg ttttgtactt ttgtaatctc     92040
     ttcttttcta atccaatcat catctaatga tgagataggt tgaacctcat ggtgttgtat     92100
     cgttttatct attctcgcct gatgcctttt ttcggatcgt aaatatttat atgcaacata     92160
     agtagaagat tttatgagcc aaccaggtaa gctttcaatt gttttccaat catttctata     92220
     tagctgtaaa aatacttctt gtgctaattc ttcagcaata ggctgatttt taacaatcca     92280
     tagaatttgt ttcacaacgt aaacgtagta ttgtttaaat aaatcttcaa atgtcagatc     92340
     cgagacaggc ctttcttcct tttttatttt taacatgtca gttaaaacct cactctcatt     92400
     tgatgcctgt attataaaga acccagaaag acgagttttg tgacaaaaat gtttattttt     92460
     ttattatgta cgaaaaaaag cattcatctt tcaagtagat gaatgcaaaa attaatttga     92520
     aatttaatgt atttttataa gtggccccaa aaagaaggaa tcgttgccgt gccccctgta     92580
     caggcagaac cacaatctga taaaggactc catggaaatt gaggatcgga ggtaatcgca     92640
     aaagctcgaa gtattaagat ttgaaatcga ttgttgattt ccctgcatat tctttccctc     92700
     attttgtttg atgaaaatct attttcaaat cctaaatcag ttcatctatt aatcatcata     92760
     acttggatca caattgtagt ttggatagtt taaatggtga taattattat tggataaacg     92820
     ttctatacta atgaaattga tatttgtata aattttatgt cctctagata tctatttttt     92880
     atgttttcta tatatttttt gtaccagaat taataaatgc agaaattaaa aaccatggag     92940
     aaaactttct ccatggtttt taaagcttta gttatttttt attaatcact cgttcatgca     93000
     aattaattca atgctttcga tataaaacga accttcggtt tcgcctatct caattcgtac     93060
     acgatctgta tctgggaata catctactgt cttcgtaata tatccttctt cacaagacgt     93120
     aaacgtcaat ttttcttgat tctcctcaca atccataagc gtgacatacc catttccagg     93180
     tccttctttt ttggcaataa cacgtaagac atacccatga ttatgttgga gatggacatt     93240
     ttgagatacg ccagcactcc aattagatag aaccaataca gaaacaccat ctatttgttg     93300
     tacgtctgca tttccagtta catgccaccc cattacccct tgtgtaaaat caccattttt     93360
     aataatattt cttgtatcat acaaataacg cgcttgtgcc actcgtgcat ccaactctac     93420
     atagatatca taattcatac ctggaacatc tgacaaccaa tcattgtaca catatggaat     93480
     cgattgtacc aaatactcag cgtactgaat ttgagcgagt gtcgtatcaa actgtaaagc     93540
     ctcatcttgt acatttgtga ataaagcatc aatggcttgt ttcgctacat catatgcttg     93600
     ttgtgtttcc gaacgttttg cttccatttg atcgttccat ttcttctcca tgtgtttcac     93660
     gcgtgacagt gcttccccat ctattggccc ttcttcaatt acttctaaat tatctaatga     93720
     tgcgtatcca tctggagaag atattttaaa catgacccaa acccctatat tttcatttgt     93780
     atctaatgcc cctgtatcaa tagtgaaact aaattgatgg gaatcctgac atacgacatg     93840
     ctttttccct gtatcatatt ggcatgaata caacatatca gaagtgttcc caatgttagc     93900
     cggcacagcg gacgtctcac aacgattaga cccttcacaa tcaaaggtag aaggatacag     93960
     atagtttaaa tcagctggaa cattcatgat ggcatcaatt tcttccccat agcgtgaaac     94020
     cactagttct acatctttac tacttcctac aaatcccctt actaggtaac gtgtatacgg     94080
     ttttaatttt gattcatcaa ttttttggaa tatataggtc ggaaatatcg taccatcaat     94140
     gtctctcgcc ccagacatat gaaggtaatg ccctttaaaa ataggatcat cttcttgaat     94200
     tgtgatatta tcacttgttg tccaaccaag cgtagccgat tcaaaatccc cgttttgaag     94260
     tacatttcga gattgactaa gttgtttcgc atttttaact tcatctaata acagcatttt     94320
     ttcttttgga tataattctt cagaaataca ttccacaaga tttgcggctt gatctatgtc     94380
     ataatctgta agttctgatt gtaaagtgtt ttttatagga tttgcataaa atgtattaat     94440
     tatttgttgt actgtttcta atttttgttt ctctctatcc tctcttatag aacgagtaat     94500
     tggcagaaat tcaattttat caataagtac tgttgtgttt gtatatacat ccgaacgatt     94560
     aaacacaaga gatatgtttt gatttggagc aaatttcacc tcgttagaaa attctaagta     94620
     ctgaaaatct ttatatttta aattcgtata atctgtacca gaaaaagtgg ggttgagtgc     94680
     catacccagt tctgctaccc ctgggatact aagatttata acagctcgag tatttgcgct     94740
     tccatttgaa gcataacgaa ttcttataaa atacgattgt tgaaaatttg agtgttgaca     94800
     tgtaattttg aaatgatctt tgaaatcaat taaatcccct cctgtatgac caggtccttg     94860
     aacaacctta gaagcagtcc caagtgaatt cgcttttaca gctggaattt gggtagttaa     94920
     atgtgtataa attgtatttt taggatcaac actagagtgt gtccaagcaa acgtatacac     94980
     ttgagtttta tatgttgcag ggatactaag acttttaata aatgataaaa tatgactata     95040
     gttatcatat gttggaaaaa gggtagggtt tccttgattc tctcttcgtt taagaattgg     95100
     taacccgaaa atatttttat ttacatcata agttatttgc ccagatcctg ctgtaagttc     95160
     tttctccaaa agtctagtac cattagttat aaaaaaatcc attttactaa tattattata     95220
     atcatttaga tatttattat ctaagcttat gacatttaat aaaaaaatat aaatatttgt     95280
     tgccaaacca agagatttta atttatcagt tacattgtga tttccaaaaa cactagattt     95340
     ttgggatata ttatcaagtg tgtaatgaaa catattataa tggctggtga aaaaattatt     95400
     aggagtagtt tgcgcttttt cataaaaatt caaagaatca agccaagtaa ataaatgcgg     95460
     tctacgtgta agtgaatcct cttgatattg aaagtcataa tatttatagg ggctttcttc     95520
     gaagttaagt acctgataaa tttctcgagt aagttcagat tggacaccta ttggatattt     95580
     acctacatca taattaggaa agagtgcaac aagatctaat acagcagtag tcatttttgt     95640
     tcgatacgta ttgtatgtgt tccagtttat atttccatca agattactat caggcgtcgt     95700
     tttaattaaa tttaatcctt ttttataagt tgttacacaa taattagtgt aatcttctat     95760
     agctttagtc aatactggat aataatcaat tgctgttggc aaaggctcta aataatcgaa     95820
     ttgtcgattg ttttttaaat acgcttcaaa tttgacggct tgatttaata cagtcagatg     95880
     taagtttgct gcttgtgcat aactagataa tactagtatg ttatagtaat cgcaatcact     95940
     aggattagga ggacaagagt ttacaagctc tggaatgaca ttttgaaaat ggtaatgaac     96000
     tagctggatt tgtgtcctta catcctgagt attttgtggg tttggattat tctcccatgt     96060
     tttaaggtga ttatgataag tgctgataac attaaacgac ctgtttaaaa ttttattagc     96120
     attacttata tatgttgatg ctatttcttt ttttataata tttttagttt gtgttataaa     96180
     gtcactccat gtgttagatt ggtcttgggc tggaaaaaga actggtatta atgtaccaaa     96240
     acctattaaa gcaagtccta agggtgttgt gaacccgaaa ccagtcagta cggtcccaac     96300
     tacaatagta taggcactga gttcaccact atcaataaaa gtttcaaaat ctccaccata     96360
     ctgctgattc tgttgacaca tattgagcca atctttataa tttgtacttt gtaataattg     96420
     ttttggacta ttttctattg gatatcttgt ataattatta gatatattta attttttttg     96480
     tgaagcattt aatgtttcat attcattttt attttgataa ggattcatat ttgttcctcc     96540
     catactcaat ttagatacac tctttttctg tagcaacaaa gattatttta aatcattttt     96600
     aaattgatat ggtttaaaaa gtacaaaatt gaaaattatt gattactttt acaaatccta     96660
     tatacatatt aatgtaccaa tataattatt cgtaatttat acattttaaa aatttttgcg     96720
     ttaaattttt aaaactttgt atttcatatg gtttgttaca aaacctcaca caaaaataag     96780
     aaaaccttct ttacaagaat tcttggtatc tttgaccctt atgcatttat cctctcctat     96840
     gtagtaatct ctctttcttt tacactccaa gctatcaaaa tttcccttat gcattttaaa     96900
     gtattcgtaa tttaaataat ctattcctgt tacattcttt caacaaataa ccgcgtcatt     96960
     ttttgacaat caaccagcct gttaattttt aaaaaagcta tctaatcccc ttcaatatcc     97020
     ctttatatgc cttttacatc aaatagtata ggaactgatg atgtttttta agctatggta     97080
     ctgctaccgt acaggttatt atttcgcgta aatttattat tttaggcatt tgaaactcat     97140
     tatacaaatt actcacgtgg cattccacct ggtttgcaat gtctggatat tctacgcctt     97200
     aataacatca aaggttctgg tgcaaataat ggacaaacgc aaaaaaaggc atagattcct     97260
     tctggaatcc actcctaagc agttaatcca aataactgat gaatacatct attctgattt     97320
     tgggcagatt gtgcccttaa tttgagttga ccttttttga ccatatgcat ggcttctatt     97380
     ccagcaatca tttttacagc tgtttgcatc gatttcaaac caagcatatt cagaattcgt     97440
     ttttttataa atcgatggtc ttgttcaatc atgttgttta aatatttttt aacccgaagt     97500
     ggcataccat atggtatgct tttttcattt tttaattctc gtatcgcaac gggataggct     97560
     ttattaccat caacagtgat tacacgaggt tttgtgacat gaaaagaagc caaggctttc     97620
     tttaaaaagc acttggcagc cttcgcatct cgtttcttac tcaaataaaa atcaagcgtg     97680
     tttccttcgg aatcaacagc acggtataag tacatgtttt cacctttgat tttgatatag     97740
     gtttcatcca ttctccaaga atcattcgtt cgtttcaaat gttttcgaat ccgctcattt     97800
     aattcgggtc catattggtg aacccaacgc ataatggtgg tatgggacaa agataaccct     97860
     cgttcttcca tcatttccac caaatcacga aagcttaggt tgtaccgcag gtaccagcgt     97920
     acagtccaca aaatcatgtc tgcttgataa tgtttccatt tgaatatgtt ttctttttcc     97980
     atcctgatca cgcacctttt ttaagtagta ataccagtat ggccaagttt gaaagaatat     98040
     tttcaaatca tttagctttt ttgcaccaga acctacattt gaaggtacca aaatgaacgg     98100
     aattaacaat aacataggta tcaatcgaca taatattttt ttcataacaa tcccccttta     98160
     ttttacataa tcatacacga ttctctttcg attttatata tttatacata tttttcaata     98220
     gttgggtata gggactgttt aattgttgag aaagatttat aagaacgttg attactctct     98280
     atcatttgct tcgctagtta acctttgcga ataccaaata gctcctttca tcaaacgtga     98340
     aaggagctat aacactttga aaaataatat gtaagtacaa gtattatcca gatgttcttt     98400
     attaatccaa cgtttgttta aagtcctttg ttcataggaa aagcatgaac aaagatgtaa     98460
     tattccccat ttagatacat taccatgtgg ccattcgttg ttctatctat acatatagta     98520
     ctctttatat cgttcgaact tcgatttttt tgtttgtggt ggtatgatgg aagactttac     98580
     tgatttagat gatgctactt gctttggcat ttgtagtaag tcacgtttct tgagctctct     98640
     atacaaacta ctcacattgc accctacttt ttttgcaata gttggatatt ccattccttg     98700
     attaaataat tgtactgctt gtttacattt tttatcccat ttttcttctg acgcttgtac     98760
     tttttgggag cgttttttag ctgtattatt ttctagttta atacactcac tttctatttt     98820
     gcactgttta gtacaatccg cttctgtatt ttcctcacgc ttattacgct tctcctgtaa     98880
     gcgtagcatt tgtacttttt tcgcaactgc tctcatgttg cattcacctc attttcattg     98940
     atacgtttta tagataagtg cttgtaatga tgttgttgct tcaaactcta atctggtacc     99000
     tgctatcccc tttagtttct caaatcattc taagaaggaa agcaatggtt tcatgcctta     99060
     atcattctat gataatttcc aacctattat ttacaatccc cgttgattaa gttgtttacg     99120
     taaactactc gcatgacatc ctaattggtt tgcaattttt tgataggtat atcctttatt     99180
     tcttaacacg agcgcctgtt gacaaataga atcccacttc agttttactt tccttttcga     99240
     atccttttca tcaaaaatca atcctgttcc taattgatat atttcttttc caattttaca     99300
     atcgtccata caatatgttc gtaccccatt atagtgcttg caacccatgc aatgttgatc     99360
     ctgcaaatct aaaatacgaa ttctcgtttc tcttttattc ataatcccaa tctcctcagt     99420
     ataatcgtta tctttattat actgaatatg atagcgtttt cgaagaacaa tagattccat     99480
     ttttcccatt tggattggtc tatccttttt ggaacctacg cccaaacaac cttacatttt     99540
     tttcatcaaa atgatttgtt tcgtcttaat tttcaagatt aatttctata caaatgttag     99600
     caatgtgtta caataagaaa tgcaaaagag taaggattca aaaaaagcca atttgtatag     99660
     aaattggctc ccttcttgat gatgacgaaa acaaaatttt ctttaaatct ttattagggg     99720
     taagttttaa agaaacatcc atcttggttc tagttttaca taattggaat ctatagtaaa     99780
     ttgatatttt ggattctgaa cattcaaaac tttaattctc tctataccca tcaacaaaca     99840
     atgtattttt cattcttgga aaaatcaaga gaaatgaagc ctatacccct caccatttcc     99900
     tgcaacacag cagatatggt gaggtatttt catgtttatt ccattataac aactatctac     99960
     gattttaaat tttttattta aaatgctaaa agaagcatcc aaaatcgaaa attttctcaa    100020
     tctctagaaa agagatgtga atttactaaa ctacgacatt tttcaaaatg ataaaaactt    100080
     tacatgcatg aagttcatga gaaacaagcc cttggtctgt tccttactga tatttatcag    100140
     cggctttttc tatagtaggc ataacagcaa ttggtggtaa tgatgcagtc caagcagagg    100200
     catgtacatg taacttatct cctactgcat agttttcagc attagaaaga ggaactctta    100260
     aaattttatt ttgagaaaca agctcccacc aatcattttg ataagaaagt gcctcttctt    100320
     ttgtcgatgt atcagcaaga actaaatagt gactatccat tgaaataaca tatccagtga    100380
     acggtatttg ttcctgtttt tgtatagtag aaattggtgt atgatgtgtg gaaacttcat    100440
     tagaatccgc aaaagctggt gtaataccaa aagtaaatcc agaccctaat gctacagtag    100500
     ttgctacggc tactagtttt tttgtaaaca taataaatta ccccctttat catatatttt    100560
     ttattgtaca cgtatatatt tcttttttta taacgtcgac ctctctttat attcaaatat    100620
     ttaacatttc tgtcacgaat aaaggaaata tatcaaattt aataaaatta tataaagaat    100680
     atgcacggtt ttcttttttg agagaatccc tagaaattct ccctaggtga aatttggata    100740
     ggcaagaaaa aagacacctc ttaggtgcct ttcttccact tgaaccactt ttatttcata    100800
     taaacttacc cgtattatcc ctttggtata tgtgtaagca catcctataa aacacaatca    100860
     tctatataca ccagattatc cgtacacaaa atataagaaa attgagatca gtattagaat    100920
     gacgccatat cctctaatgt gattgatatg ttacgccttt caaaagaatc tgttttatag    100980
     aatgtattca cacccattat tctaccatat ttattatcta ctacatttaa atttctaaac    101040
     attatgcata attgcatggt tacattaatt ttttccattt ctcctcgaaa atgtacgttg    101100
     gaacctttac aagagaataa ggaaaccaga aaataacacc tctatagaca aattctttaa    101160
     cctaattttt atattttggc aactatatcc ttcctacaaa ttatctctgc gttgtcttct    101220
     gtatcttaca ctgttttcga tttattctac taaataactc atctacttca ctctgctgta    101280
     ggggcacgac aacatcgcca tcaagctaag gaaaaggaga tacccccaaa ccgaataaaa    101340
     taggggtatc tctttttata tatctaactc tatttctttg ctcatgcaac agaacttata    101400
     tttctttcca ctgttacaag cacatgtatc atatatatcc attggacgtg tccgtccttt    101460
     catcgctttt ttcaaatctg ttagatcttc atttaattct aaactaatga tgtaatataa    101520
     atcatactca tcacaaattg ctgctatttt ttctgctcgt gctcttgttc ctacttttat    101580
     cataatcgga ttattttctg aacctaatag acacataagc tttcacctct tttcttttca    101640
     tcttcatttt ataaaataaa gataaaaaat ggaggggaat ccatgaaaaa atcatctcat    101700
     tttaaagact ttcgtttact tgtaaaagaa ttacagcgtg tattttcatc acacttttta    101760
     acacatttgg ggaaagaaac acagtttgtt caacgtacca gtaaatttgg agcacaagat    101820
     ttagctgctt tatgcatagg aatgggccaa gatattgcaa gttattcttt gacaagacta    101880
     tgtggtgttt tagaatcaga aacaggtgtc cttattagtc cggaaggact aaatgtacga    101940
     ttaaacgaaa aagcagtaga atttttacgt tcgctcttct cgcaactctt acaaaaacaa    102000
     ttattagcca ctatatctct accttcttct ttttcagaat actttcggcg tattcgtatt    102060
     ttagatgcca ctacatttca aatttcagat caactcgcag ccgtttatcc tggttcaggc    102120
     ggaagtggaa aagcttctgg agtgaaaata caattagaat atgatttact gagtggtcaa    102180
     ttcttacatg ttgcattggg acctgcgaaa gaaaatgatg tgaattacgg caaagaagtt    102240
     caacctaccg ttgatttaca aggtctttgt atacgggatt taggttattt tagtttgatc    102300
     gatctagatg gcatccaaca aaaaggagcc tactatttat ctcggcttaa aatgaatacc    102360
     aaactgtttc aaaaaatgaa gaggccccta tttttaaaaa tggagcaagt aagaaaaata    102420
     tcaatataca atgattgatt tagaaacgat tatggaacag ttacaaccag gggaattata    102480
     tgaaattcct gttgtctatg ttgggcgtga ctatctactt ccagtaagag ctgtaatgta    102540
     taggcttact cctgatcagg aaacacaacg tagaaaagat cgagcataca aagaaaaaaa    102600
     gaaaaacata acgtttagtg atcgaacaaa aaaattacaa ggcatcaatg tatacattac    102660
     gaatattcca ttggaatatg tttctaaaga agctatccat gagttctact ctcttcgttg    102720
     gcaaatagaa attatcttta aaacatggaa atctattttt cgcattcatt ccaatacaaa    102780
     tgtgaagaaa gaacgattag aatgtcatat ctatggaaaa ttaattgctc ttttactttc    102840
     ttctactgtg atgttccaaa tgagacaagt attgctgata aaaaaacaaa aagaattaag    102900
     tgaatggaaa gctatgtata tgattcatga ttatttccgc gtattatatc gacaaataca    102960
     agaacaatcg aagcaactaa taacaagttt tcttcgttta ttccacttac ttgataaaaa    103020
     tggacgaaaa tcacatcgtt atcgaaaaaa aactgtattt gatattttag gtactgcata    103080
     cgagcagtat atagaaaaat aaatccgctt aaaaaaattg tagcccgcta gggttatttc    103140
     gtatgcactt ttttataaaa aattttaata ttgggtaaaa gatacccaat attccatagt    103200
     cggagaggaa tttatacgta tttttgtaag ttcaatttcg ttagcttgat ggcgatgttg    103260
     ccgtgcccct ataggagttt gtacagttgt tttagcagga atagccgcaa ttggaaagaa    103320
     acaaataata atcgcaaata tacatctatt attggccatg tattattttt gttcgggaag    103380
     tcttctgtat ttgtgcacgt tatgggaaac acaagatatt ttcctacaag cctttttgat    103440
     tctaattgta ggaattacga tcatgcgatt aagaaaaagc tggtatgtac cgcaaatgcg    103500
     tacgcttcaa aaactgcagg aagaagcaac aagtaagaat aatctgtgag gaaatttaag    103560
     gggagaagga gtggaggaat cttgatacat caatatgaat tgaacttttc agtgatgtac    103620
     agtggcaagg taacagactc acaatctacg attattccag cacaatcttt agaggaagca    103680
     agtaagaaat tgcattcgga agtaaagcgg ggattaggaa aatgtagtat aaaaatgaat    103740
     tccgcaagtt tatttgtttc agaagaagtt caatatacag tcttacaaaa gtgaaaatca    103800
     atatcgtgca taaaaatgaa gaagtaagcc ctcttcctta ttgaaagtaa taaatcgaaa    103860
     agtcttgttt ctgcagcaag acttttttgt tattttgtgg ggctttttta acatgaaaat    103920
     tcctattgta aaagggtatt aagttgccgt tttgagaggt gtctttttct tttaaaaagc    103980
     ggactgaaca tctaggttaa acattgttgt tataaggttc ttaaggaaag caggtatatg    104040
     tgcataagtt atgcacccta aaatagactt aagcacatat gtctaggtat gtgtgcttaa    104100
     gtctatgtga ctatcgttat gtgaccgatg gagagatttt caaagttatg gagcatgaaa    104160
     aatctatttt ggatacaaaa cataagaaaa ttgtgcttct gctgattgaa atggctagat    104220
     tatatgatga aatgaatcat tcaagtggtt ggaagtgtgt tgggatggga gtagattttc    104280
     tgttatgata gaaaaatcaa tgaatcagcg aggtgaaagt aatgattttt ttatttcgat    104340
     ttgatgtgac agacaaggga atggatttta ttctgaatga agaaatagca aaagatatgt    104400
     atcctgattt ggaagaaatg ctccgtgatt tagtgagatc tttatgctca atgcttgaat    104460
     actataaagt ctataacaaa gagaaaacca tcttttcagg attcattcac gataatgggg    104520
     aagcggaggt tacactcagt aagggtttgg gaaaatacat tgatccatat accaagaatc    104580
     aaattatctt tgatcatgga aaacttatta ctgaactttg taccacaatc atggatcgga    104640
     gatcagcaga agcccaatta aaaggagaac gatggtagat catagttcta ttttcataaa    104700
     aaagtttgat taaattgtaa ggactgataa gtggtgagta gttcaatgaa atacgtttta    104760
     gaaaagtttt atacatacgt agaaaaataa agcactcata gctaatttgt tgtatactaa    104820
     agaagctcaa gcaagaacta tattatgcgg ttttaggcat aaaaaaacgt cttttatcag    104880
     cacataaaag acgtttttta tttgaacatt attaacatag catgtcttat gagtagtaag    104940
     acatgctact ttcagaaaat gtgctgattg tgaaacgtat attatcccta catagcttgt    105000
     tgcacaaacc gaatccgcaa gtatatcata tcataaatca atgatgaaaa agcgatgtgt    105060
     ttcaccattc tttgtatata tttctaatta gatgtatact aaatatgatt tcttttgtga    105120
     aaatttttag gtgtttttca agtcaggtta tggtcgttat ctaatctatt gtatgtatct    105180
     gcagtgaggc tcttatgtta atcataagag cctgtttgca tgttcaattt gtttttatgt    105240
     acaataagaa aaaagagatc ttatcagaca gggagaggaa gcccatgtcc aatcaaaaat    105300
     tggtcaattt acgtattgat tttgccttta aacaattatt cgggacatcc ggaagcgaag    105360
     atattttgtt aacatttcta aatgcaatgt tagctgattc attggaatcg ctcattcaat    105420
     cccttcaatt cgaagatcca catttacatc gagaacatga agaggataaa ttatcgattc    105480
     tagacgtatc ggctacatta gacactggaa ccaaaattaa cattgaaatc cagttgaata    105540
     ataatcatga ccttttaaag cgttccctat attattggag caagctctat gcatctcaat    105600
     taaaaaaggg aatgccctac agctcattgc ataaaaccat tacaatcaac ttattgaact    105660
     ttgtcatgtt taaagactat gaagcatttc atacgacggg gaaactgtgg aatatgcaac    105720
     agcagcaact cttaagtgat gatatcgaaa ttcatgtcgt ggaaattcca aaattgctac    105780
     agcagtggcg agaggaaaaa gtaaatccat gggaagattc ttttgttcgg tggttattac    105840
     tattaccagc caatgaagat gagcatttaa cacatactct ggaggcgatt gcgatgaatc    105900
     aggatccaat tttacaaaag gcaatagata aatgggagca tatgagccaa gatgcttcgt    105960
     tccgtcaagc atacgaagta cgcgaaaaga tattgatgga tgaagcagca ggtattgcac    106020
     atgcgttaaa taaagggcga gaagaaggca tgaaaaaagg acttgaacaa ggcgttcaac    106080
     agggaaaacg tcaaatgatt ctcggtatgc atcgtttaca agtcccaata gaaaccattg    106140
     cacaagccag tgaactcacg attgaagaag taaagaaaat catagagcag gcataaaaga    106200
     ggcggtccaa agaccacctc tttttacgaa aaaacacaac aaagacagtt atgccagact    106260
     gtctttgttg tgtttgtgat tttgcaagtg tttgtacgta tatatcatat caaaataggt    106320
     tctaccatac aaaagaaaag tctatatgta tagagtgtgt tgtgggaaca ctcctcaaaa    106380
     aaagatacag ccacgataat ccgcgactgt atcttttctc tgcgtaaact cactatatct    106440
     agcaactaac ctttacagat tgctcttcat ttcacagtat accttaactt gtggtgaaaa    106500
     tacatatgtt ttacactaac cccttgaatg cccccctggc tcacgatgat gtccgccacc    106560
     atttccttgt gcatacaatt cagcgggcac gtcaatatga tgacctgtat ttccgtgagc    106620
     ggatttagaa cctccaccat ttccatgttg actcatatac cctgtattcc catctgcact    106680
     tctaaaaagt atgtaattca ttgtgatttc ctccctttct aaattatatc ttcatactag    106740
     cacagtgtat tagggtaaaa catcattaaa tgattaaaaa ttccgatatt tcaaacgttg    106800
     tgcaatcgca aaaataacag gaacactaac agaattaccc gcttgtcgat acaattgtgt    106860
     atctgaattt actttacttg ctcgttcaaa agccgaatct gaaaaccctt gaagtcgtca    106920
     agtttctttt ggtgtaagac gtctaattct agaatcctct gttagtactg cctgattgca    106980
     agctgtatcc aatgattgat aatacatgtt aaaagacttc acctaaatag tttaatccta    107040
     aaacttcctg agcagaatat aaaataagga aggtgattgg gattggtgaa gaccatttta    107100
     attagagatg acacattggc gcatataaaa aatgatttag ttgaaatcag tcagtctaat    107160
     gtaaattcca aaggtttaac tcatgttcaa attactttaa acaaaaatga aattatacat    107220
     ctcgcgaata aactacaaag tatgtttgga aaagtagata tttgtattca ctgtgataaa    107280
     gtgatagatg catttgaaat gccttatcga tataaaagtc gcaaacaagc acatctcggt    107340
     tgccatattt ataataatag agggcgtgta taaattaact ccccatcttt tatggagtga    107400
     acccagagaa tgagacgaaa aaaaaacacc tctctaaatc gtaagtatca ttatctatct    107460
     tgttaagaaa gaataacgtt ttttgtactt gggggtagtg gaaattctta agttgatggg    107520
     catgggttca ccatatcaaa aaaagaaaat tgtacgttta gacacatttt agacacaaaa    107580
     taaccggtac cttgtatgtt aaggaaccgg ttattaatgt tgcaaatttt ttactaaact    107640
     tatttataat gaacgtaaat taactacatt ggtatacctg gtaaaagttt agccatcaat    107700
     acaataattg ccgctaagaa gactgcctta ataatgaata gaataataat tggaatcgat    107760
     gctttcactt tgcttaatcc agctgtaata tgtaatccaa gccaaattaa ggctaaattc    107820
     catacataga atacttcaat tgtattacca attccatatg caaatgtacc ttccgtaaat    107880
     aataatccta aacttgtata ttgagtcatt ccagtaccaa aaattagact taaaattgta    107940
     ttaataagtc caccaataat aaggacaata tttgtataaa ctacaatgtt tactagggtt    108000
     ttataagggg tatcattccc aaaaatcatc ataaacatct tataaatagc tgctatgaat    108060
     agtgttccaa ccatcgcact agcaaaactt gagccaattc cagaaatcac ttctgatgta    108120
     agtgaacttt gaccagcaag ttcacccaat tcctttttca ttttaagcat ctcaggtgaa    108180
     gtatgtataa catacgcact taaaccaccg agcagcccct gtaacagtgc tactaagaag    108240
     aatacacccc aaactctctt acttgttttc attctttcaa actgtaatcc aggagatgta    108300
     atcattccaa ataatgatgg ctttttcaca cctacatctt gtattttcat attcgcttcc    108360
     attatagcgc ctccttctat ttatataatc ctcttaaagg ataatccaaa caattcactc    108420
     gaacaatatg tatgaataat agaggtactt atctctacta ctctagtaaa ctattcatag    108480
     cgaagtgctt caattggatc taatttcgca gctttatttg ccgggattaa tccgaaaata    108540
     ataccaagtg tcattgagaa taatacgccc ccaacaacaa cttcccatga aacaagcggt    108600
     ggccatttcg caaatgtcga aacaatatat gccccgccat atccaagacc aataccaatt    108660
     aaaccgccaa gaagcgttaa cataactgct tcaattaaaa attgtaataa aattttacta    108720
     cgtgttgcac caagtgcttt acgtacccca atttcacgcg tacgctctgt tacagatacg    108780
     agcatgatat tcataacacc aataccacca acgactaatg aaataccagc gataccaccg    108840
     atgatcattg tcataatacc cgtcattttt gaaatacctt cttgaatctc ttttaaattc    108900
     acaacttcat atttaccagt tgcatcactt ggcttgcgac tgtttaagac atccgcagct    108960
     tttttacctg cttgctctaa atgatctaca ttttttgctt gaacagaaat attttgaatc    109020
     tcatcttttc catacagtgt cggccataat gaaatgggaa cgagtgcttc tgatggtccc    109080
     attcccataa acttgttatc tgatttgtag acaccaataa tttgcatcgg ttgacctttc    109140
     acttcaataa ttttaccgac tggattggca tccttaaaca ctttttcttt catttgttta    109200
     ctaatcatga caacgttatt accttgatcc acatctgatt cttgtagcga acgtcctttt    109260
     agtactttca ctttattcac cgtgaagtat tcattgtcta atccagtaat attcaccatc    109320
     tcttttttat cttcaatatc aagagactcc atacttgaat ttgttgttac gatatgtgca    109380
     atctctggga ttttcttgag ttcaaaaata tcttcttctg ttatttttgg tgcttcagcc    109440
     atatccatac caaaaggatc atttatatca ggactataat gaatgggaac tgtttgattc    109500
     cctgatccaa caaattgtga ttttaaggca gcttctccgc cttgcccaat cgcaacgacg    109560
     gtaataatag agcctacacc gataataatc ccaagcatgg taagagctga gcgcagttta    109620
     tgagctaaaa tagacgataa ggcaattttt atactatcta gtaaactcat accgcacacc    109680
     ttctatcttc agtaattttc ccatctcgca gtacaatgcg gcgggaagaa tacgctgcta    109740
     cttcctcttc atgcgtaacc atgacaattg tcgtaccttc ggcattgagc ttcgtgaaaa    109800
     tatccataac ttgctcacca gacttcgtat caagtgcacc agtcggttca tcggccataa    109860
     tgaacgttgg attattcgca atcgctcttg caatcgctac acgttgcttc tgtccacctg    109920
     ataattcatt cggtaaatga tgtacgcggt ctgctaatcc aactttacct aacgcctcta    109980
     aagcacgctt atgacgctct gctttcttca cgccaccata tacgagcgga agttcaacat    110040
     tttccaccgc agaaagacgt ggcagtaaat taaaatgctg gaatacaaag ccgatatatt    110100
     cattacgaat taaagcaagc tttgactcgt ctgctgttaa gatattcacg tcattcagca    110160
     tatattcgcc ttctgttgga cgatctaaac aaccgataat attcataagc gtcgacttac    110220
     cagaaccaga cggtcccata atcgaaacga actcaccgct ctgaattgtt aaactaatat    110280
     catgcaaaat cggcaccgcc aattttcctt gataatacgt tttagcaata ttatttaacg    110340
     taatcatttc tctttcactt ccattccgtc atacacatcg tcggaaggat ttttaaccac    110400
     cttttgcccc actgttacgc cttcagtaat ctctgtccaa tctccatcag tagaaccttt    110460
     tttcacattt tgtttacgaa gcttcccttt atcctcaaca taaacaaatg catcatcggc    110520
     tttttctaca atgctcttac ttgggacagc aatcatcttc ttattctcta agtttacttg    110580
     cagagaaacg tgataacctg gagataaacc atcttgacta tcaaggctag ctttatacgt    110640
     atattgggac atattttgag ttgcttcacc catgccgcca gcttgcgcca tctctgcact    110700
     tgttgggaac tcacttacct ctgtaatctt acctgtccac ttcttcttat tatttgcttt    110760
     cgccgttaca gtgaatgttt gatccttttg gatttgtgac ttctgaagct cagttaacgt    110820
     accgtggact tggaatggat ctttagaagc tacttgtaaa aacgcttttc cttgaccacc    110880
     taacgcttga gatgaacttt gtgccgcatc tttatctagc ttttgaacaa caccagcaaa    110940
     attactgtaa attgtaagtt ctttctgctt cttacttaac tcttctttct gcaactttcc    111000
     tttttctttc tcaaggtcaa ttgttttttg tcctatctct aactcgttta cttgctcgtc    111060
     cattggatct gttacttctt tcccagctcc gctatctttc gccttcttaa tttctttctt    111120
     caacgaatca atcttctttt ttccttgatc gtaacgcata tccgccatct tctgatcaag    111180
     ctcagcttgc ttcatttgaa gattaatctc ttcattgtca taagagaata acttcgtacc    111240
     tttttctacc tcttgccctt cttttacctc aatatctttc actttccctt tggccggatc    111300
     tgcatagaaa ctttcaatat taccaggctt cacctgacca gaaattaact tcgtattatt    111360
     cagcttacgc tctgtcactt tctcaaaact tacagcatca gcacttgttg atgcaacctt    111420
     cttcttacct tgcataacaa aaatattaac tgctgccaca ataacaatta gtgcaataac    111480
     cccgacgata atccatattc ttttattatt agaagtagta attttagata ataccataga    111540
     atatccccct tcaaaataaa gtatttctgc gaatccgttt ctaatttaga taattgtttt    111600
     ttctttaaat atcgttatta tatttgtaaa aaaaatccat ttttccacct ccttgtaatt    111660
     atagcaagat atttgtaaga atattataaa tcgcatcttc tttgaactta aacgtcgcta    111720
     gaatttgtaa tgcaaggcac tttttatata attttaaatt taagttccat tcctgcaaat    111780
     acgaataata tcctatttat atataacatt ttattatcca taaataacat ctgatatgca    111840
     taattgcata tcagattgta ttgatagata gtattttggt atatataatc atttgtggaa    111900
     atacatttaa ttatttccat tgcaattatt tatatattag gaagaattat taatgttcga    111960
     gattatgggt tattttgggg tagaccgtgg ttgggctact aaaattgtaa atgctattga    112020
     tgcagtaggt tggggagttg cagctgcaag tgcaatcgct gcaattgtta cagctggtgg    112080
     attagctgtg acaagcgcaa tgattgatgt agcaattttc actgttaaag attttctacg    112140
     cagaaaccta aaagcacaag ctgttgcatg gtaatcatat gattccagtt aaaataggag    112200
     agataaatat ctctcctatt ttttctatag aaaacatata gcgagtctaa atggaggaaa    112260
     agtaatgaaa ggttctcaga tgattattct gaaaaatata gttttagagc agattcggca    112320
     agattttgct ggagtaactg agaaagttaa aactaaatta ggaattcgac ttccaaattc    112380
     attaaattgg attattacac ttctatttca aaatacatta attttatttt tcgccttatt    112440
     atttgagggt attacggacc cagaaatcag aaatatagtt atagttgctg ttttgttatt    112500
     taattgtttt cttccaagtt caatggctag acaaaactca attagagtta gtaataaccc    112560
     tttgtatgat ttattatggc aatctaaatt caatcgtaat caattattaa attttacatt    112620
     attagctgaa gtgctagttt tctggttgca tgaattaatg cttgaaatta ttgcgttcta    112680
     tgtaatcatt aggatatctc cagattggat tactagtatc actttttgta taggttggtt    112740
     tcttttagta tcatcaattt atttttcaaa aatgaaaaaa ttagttttag aatcatggga    112800
     aacatctatc tccgtttcaa aatatacaga actattttat gtattaaaaa taggaattat    112860
     tgcattaatt atttcgtttt taactaaact gttatttatg ccaataattc aagagccgat    112920
     tactaaggat gtctaccgac aaggtattta taagctattt agcgtgttct ctagtcgcgt    112980
     tgaacacact tttaaagaaa atctaggatt aattttcaac tattttcaat ttagttggct    113040
     atattacata ttaggtggac tcctaatttt atacataatt tcagctattt attattttta    113100
     cttttactca ctccaaacac atctagttag acataaaaat agagtaaatc ttaaccaatc    113160
     gacaagtaga atttttaaat tttaccaatg gttaagtgaa gtgctttata aaaaacaccc    113220
     ttgggtcaaa agagatgtaa ttattcttga acgagttatt gtaaactcca atcttcccca    113280
     taggatatat ttgtttctac ctcctgcaat aagtgcttta attggtttta caatcttatt    113340
     attaggaagt ttacaatcat attctggttt tattttggcc ttctggttca ttggttggat    113400
     ggtgttatcc caaactagtt ggttatggtt attaaattat ccaattttac atccaggaag    113460
     tgaattaaga caaattgatt tagtaaaatt gtcttcacat tttactgttc aacaattttt    113520
     gaatagtaag gggaaattag ttaatatttt agctttccca ttacaatgtt tcttgacaat    113580
     cacactatta ataggtttta ttttactaca cggttctatt tacgaattaa ttgttggaat    113640
     tcttggtatg tggctactct tcttcataaa tgggggatta tcaacatatt ggatgaaatt    113700
     atgtagtcgt tttgattatg caaatatgtt tatggtacgt ctagatagct acgaagctaa    113760
     atttctacaa caattcttta ctattccaaa acgtataatt aatggtctgt tatttattac    113820
     atttttcatt ggggcattta tcagtgtcga attaagtcaa caactcattt atgacatctt    113880
     tttaatcata gtagtattat ggggatttag tttatatttt gtaaaaaaat aacgtaataa    113940
     aaggtcggat tggaataatg aaaaaagtaa tagcacacat aagtttgaaa tatatatggt    114000
     caaattattc tagaaagttc actttaattt ttttaatatt aatggcctcg tgtatatggg    114060
     gaggcatcta tcaaagccat caggctcctt tgccacctaa ccctccagat tataattgga    114120
     tgcattattt ttcacacaat atggaacaat ccttattttc tattgctgta ggatttatta    114180
     cttacgggat tggtagtttt atattgttat ttatgaatgg aatggtaata gggattgtac    114240
     tagccatgac aatacaacat gacatggtag acactatttt tacggcattt ttaccacatg    114300
     ctatttttga attaccagct atgatgatag ctgctcttgt accatttata atttggaatt    114360
     ttattaaaaa aagtatacgg cttcgtaaaa ttcaatatac cttaattaaa gctgaagtta    114420
     ttccttcagt tgtattaata gtgattttat tatttatagc ctcaattatg gagagtatgt    114480
     ttgccattta aaaaaggagt tttcatgatg cttgagataa aaaacttaaa atttcaatat    114540
     gaagaaaata ttccattgct acataatatc tcattttctg caaatccagg agatattatc    114600
     tggcttcaag gatctaatgg ctgtggaaaa agtacattat tacgtataat ttcgcagtta    114660
     attgaagttg attatgagtt ttactataat caacaaaaaa ttgaatcaaa agaagatata    114720
     ctaacaaatt taatttatat tccttcagaa ccttatcttt ttgattattt aacaggtgaa    114780
     gaaaatgcag agtttttacg aaccctattt gatatttcta aaaatgaatt ccaacaattt    114840
     ttctcgaaaa tgacagaaga atttcaaatc aaacatgcac ttcaaaaatt tgtacaagaa    114900
     tattccttag gaatgcgtca caaattgtat tggtccgcag tttttgcacg taacgcacca    114960
     attatattat tagatgaacc attttcatct ttagacaata attctcagga aatcgctatt    115020
     agaatattga aacaaaaagc gactgaagga gcaattataa tatttgtttc tcatcttcct    115080
     gaaattagtg agaagctggc aactagaggg ctaaccttag agggtggaac aataattaat    115140
     agattttaac ggttagtttg tagaaaagga tgagagttta atgaattatt tgagtcaatt    115200
     aataggaatt ttactaggct taattatgta cctttgtata ataatcagca tgaaaattgg    115260
     ggataatacg tacataggag attacttttt taaattattt aacatgaata ataataaatt    115320
     tattgttgca atcacttttt ttgtatgctt atggattgtt ggaaagatat ttaaagacaa    115380
     acaggccata tggttaaatt ggggacgatt acttttaact ggactaatgt tggttgccct    115440
     agtttcatat ttagtaatgt aataacacta ttaacccctt aatactacat acattgtaac    115500
     caggaaattc aatattattg ctttttaatc acaaaaaagg agaagaatga caaacattct    115560
     tctccttttt tgatgtttac taaaatccat atcaataggt tgttctttta gattcccatc    115620
     ggccgttttc aagttttaac aaaaatatat gctaaacaat ttcgaaataa actaagtcga    115680
     atttcatatc ctaagaagca ctttactttt attctttata aatcattttg ccttttttta    115740
     cttcaaattc tttgattatt ttatagaagg tatttttctt taattcaatt aactccataa    115800
     acttaatccc tgttatttct ctgtttttcc actttggata agtttcttct attatttgta    115860
     gttgctttga gcttaatgtt gcaagggtaa gttgaggacg tcctaaatgc ttaccttgag    115920
     atttagctac ggcaatccct tctgcttgtc gctgatgaat ttttttacgc tcttgatccg    115980
     caacgtagga tagcaatgat aaaaattgat cttccattaa tcggcccata tcacccatct    116040
     cacgaaattt tcgactatca aacaaggttt cattttctaa aactacaata tcagcttgta    116100
     attctcttgt tatatacttc cattctgaaa ttacctcatc ataattacgg cccatacgat    116160
     ctaaggcatc tatgtaaaca atatcacctg tacctaatat ctttcgtaat aattgatatt    116220
     gagggcgatc aaaatgtcgt ccacttgctt tgtcgacaaa aatacgccga gcttccactc    116280
     ctcgttccat catcttatgt aattggcgtt gttcattttg atcttttgta cttacacgta    116340
     tatatccata aatattcgtc atttttggta ttccccttat atttgttacc ataattatac    116400
     cattttcgtt tataaaggtg ttcattaaaa ataaacgttt ataaaataat tataataacc    116460
     tttataaact tgatatttca atgttttata gatgatacct ctatgtttgt aaaggtatat    116520
     ctttttaaac agatgtttac tttctctatt gttgcatgag aattttcttt tttaggagaa    116580
     ggtaattttg agggactata tttaaccaat ttacaatcct tatacatata aaattaaaaa    116640
     gcattgggta acagattcat aaaatcgaac agttattgca gaaaaacgtg agcccacatt    116700
     aacaggaaca acttgttatc cttttgacta gataggagac gctccaaatc ggtacataat    116760
     tgaattatct ctattttcta ctcgttcata gggagggcta agactttctt gttcattttc    116820
     atttattgaa gataggcagt aacttaattt tctcaatacg atttttttga ttttaatata    116880
     aaatttttac attttatgct atatctgtat taaggggccc ttgttgatga ttagggaaaa    116940
     aaattatatg ggaggcacaa aaaatgtcat taaaaaagaa attaggtgct ggagtggttt    117000
     cagccgctct tggtttatct ttgattggtg ggggaaccta tgcatatttt agtgatcaag    117060
     aggtcacaaa taataaattt gctgctggaa cattagattt tgctatgcag cctaccacat    117120
     ctcttaatct agacaattta aaaccagggg ataaaatatt aaaaaaattt aatataaaaa    117180
     atagtggtac gttggatatc aaagatatcg tgatgaaggt tgattatact gtgaacgatt    117240
     ttaaaaaaga taatggtgtt gaagattttg gtaaacacat taaagtacag tttctgtggg    117300
     attgggatcc agagaaaagt cctgtatatg aaacaacctt ggcagaatta aaatcacaac    117360
     atccagaagt tgcttctcaa aaaatattcc tgtcaaaatg ggcagaaaca ggtggattaa    117420
     aatctggaaa aacggattgg ttttggatga aatttacctt tgaagacaat ggtacggatc    117480
     aaaatatgtt ccagggagat agtattgcga tgaatatgga gttccaagcg aatcaaacag    117540
     aaggacaaga aagataatat tgcaagaccc atatatgaaa gtaagacttc taagacataa    117600
     cattttagaa gtcttacttt catatttcaa atcgggataa gacttgtgaa aaaagtgtaa    117660
     cctgtaatca tactaaattt ttatctgtta aaaaaacttt gtaacagaac ccagcacttt    117720
     atcttgtttc ttattttcat ttaccttagg ctttgtctca tataaattgt ttaatacacg    117780
     attatactca tttcttgtaa tttctttatt atacaactga attaataaat ctttatgctc    117840
     ttttgaaaag gccattttat caaaaaactt aggatacata gtaccaatct ctccgcttca    117900
     tgttgggttt tatatgataa accagaagta gaaaaaccca tatctatata gaatagggat    117960
     gggtttttca gttactattt tagacgtcgt tgtatagtat aaatattggc tgagtattat    118020
     attataacat aaaagttata gtcctagttg tttttctaaa ggtttcaggt acctacaaat    118080
     gtttctattc gaattgctcg aacgtgctgt ccatcggtta ttgttttatt ctagaatcga    118140
     atcgtagaga ttgcatgttt atatacaagc tgttgtttcc cctcatattc tattaaaata    118200
     gaaaaagtat catatcctgt tattattcct tttatatgta gtccttttaa cagaattaac    118260
     gtgatatcct tcttcttttg aaacgcttct tgtaataagt gttcctgtga aaatagtatg    118320
     ttcttacctc tatccttttg aaatgattgt aatttcgttt ccaatgagtt ctcctcctat    118380
     tcttctcata cagtcacttt gtattgttct agttcagcta acagttgttt tagaccctct    118440
     ggactcaatg tcagctttcc acctactagt tttacattcg ttgaagatat ttctcctgtg    118500
     ataggacaag taccatgagg tgtatatttt tgtagaacaa tcgcatcttc ttctacaaaa    118560
     aattctaaag tatcgcttgt ttccacctgt aacgtttttc ttgtttcttt tggtattaca    118620
     attcgtccca aattatctac ttttcgtaca atacctgttg ctttcataag catgccctcc    118680
     ttttttacaa atagaatatc ccacatatcg cgtaatcgtt tacattattt taaaattata    118740
     tatactataa aaaagtttat ctcaatctgt agaaatattc tccagttctt cttacgtcca    118800
     ctgttgcaaa ccctctattc tcttcatgct ctcaatcact ttttcgtcac ttactatata    118860
     ataaacctca tttccttttc gctcatagga aacgatctta aactgtttta actttattaa    118920
     ctgctgtgac attgtagatt gtggaacacg tagtaacttc tgtaactcgg atacatgtaa    118980
     tggacctttc gcaattaatt ctcgaacgat catcaaacgc ataggatgtc caagcatccg    119040
     caatatatct gcaggtctct cgtaatactc aatatccata tagaaagctt ttggcataat    119100
     ctattcccct ttttggatga tcgtttttta tatcctaata tcatctattt gttccgccaa    119160
     tgttatatat atgcaagggc tttatctaag tatctatatt cttataacta tattattcct    119220
     caaaattctc cctatttcct ctttgtatct tacattgctt tcgatatatc ttactaaata    119280
     actcatttaa ttcactttgt tttatattct ctagtatttc taatactcgt ctaaacgttt    119340
     tcctccaaga aatttttcat actttaattt gcttcgtaga gaccgaattt tgaagttttt    119400
     cctttttctg ctgttccttc agatgctcca attgcaatag tctctttttc atacataaat    119460
     aatcctttgg aatatcttct cgcagactta aatcatatag taaactgtta aaatagttcc    119520
     gctgtcttaa tgtagacttt cttctacgca tagagtgttc catctgttgc aatagctctg    119580
     ttagctcaac agtagaaaaa ttcacttcta tccacttctg aaaaaaacgt gttttttcta    119640
     aatagacaat tacttgcttg acaaacgcat ccgtaataaa agatttatct tcctctacaa    119700
     catagtccat atcctgaaga agcgtacgaa caattcctcg aatatcagta agaaccccct    119760
     gttgtaaaga gcgttctaaa tctgtaaata ccattctacc aacaatcctt tcttacaacc    119820
     acgtagtcta attaacataa aaagttcggt ccgtatgttt tttagtctaa aaaacatata    119880
     gtaaatatat aataataact ataatgtaat agtatcaaaa tcggtattga gaaaatagta    119940
     aaatgaatat atgttgtaca tatttattgt atactataaa taatctgtca ttaaatccct    120000
     tgtatataag aaaagcgaga taaaagaggg ttctggtgca aaaaagctaa atgatttgaa    120060
     aatattcttt caaacttggc catactggta ttactactta aaaaaggtgc gtgatcagga    120120
     tggaaaaaga aaacatattc aaatggaaac attatcaagc agacatgatt ttgtggactg    120180
     tacgctggta cctgcggtac aacctaagct ttcgtgattt ggtggaaatg atggaagaac    120240
     gagggttatc tttgtcccat accaccatta tgcgttgggt tcaccaatat ggacccgaat    120300
     taaatgagcg gattcgaaaa catttgaaac gaacgaatga ttcttggaga atggatgaaa    120360
     cctatatcaa aatcaaaggt gaaaacatgt acttataccg tgctgttgat tccgaaggaa    120420
     acacgcttga tttttatttg agtaagaaac gagatgcgaa ggctgccaag tgctttttaa    120480
     agaaagcctt ggcttctttt catgtcacaa aacctcgtgt aatcactgtt gatggtaata    120540
     aagcctatcc cgttgcgata cgagaattaa aaaatgaaaa aagcatacca tatggtatgc    120600
     cacttcgggt taaaaaatat ttaaacaaca tgattgaaca agaccatcga tttataaaaa    120660
     aacgaattcg gaatatgctt ggtttgaaat cgatgcaaac agctgtaaaa atgattgctg    120720
     gaatagaagc catgcatatg gtcaaaaaag gtcaactcaa attaagggca caatctgccc    120780
     aaaatcagaa tagatgtatt catcagttat ttggattaac tgcttaggag tggattccag    120840
     aaggaatcta tgcctttttt tgcgtttgtc cattatttgc accagaaccc aaaaaatcaa    120900
     attggttgta ttaagaatgt ttgatttctt aaagaagtat ttaaagggtg tcttgcatgt    120960
     acttgaatat ttgtaccatt agtagtttgc gaaccagcta cttctaaaac taagtctgga    121020
     ttcattttat ttttaaatat atattcatta ctattattaa cacgctctat agcccaataa    121080
     tgagcatcat atgtttcaat aagctgcgta gtaaatacat tggccgttcc acctgcagcg    121140
     ttccaagcca acactatatt tgaggcacga ttacgtcgta ttacataacc attcttaaca    121200
     ctgttgtacg agagatacca cttttgagta tctgccttat tattggacat taatataaca    121260
     ttggtatttg aggccccctc caaacttact acactactat tatttaatgc tgtcacaatt    121320
     tgatactctc cattaaaaat aggactcatt aaacatctat ttctccaatc attacaatta    121380
     acagcgtaca tatccaatct atttgaaaac tgttctataa ttaaatatgt gcgttgggat    121440
     gcaccaccgg atagaaaaat aggtatatta ttatacgata tctgatatcc aaaatttgta    121500
     tggagatgcc cagcaaaaat tgctgcaaca ccatattgtt gaaataaatt tttatattga    121560
     tcataaagca tttgatgttt atgaacattt attatgatag ttttcccatt tattctagct    121620
     gtttctaatt gagttcttac ccaatcaaag ttttcaaata tgtgatactc attaaaatcg    121680
     gtaatagttg ggcctgtttg cttattcatt gtaggaaaat tttgtaattg gatagaacat    121740
     atcgatccga aatttactgc ataagcaaaa ctgccttgat gctttgtaac aggaataccc    121800
     aaataaggtt ctcctggttg agtcctataa tcaaattgag ttgatggtat gccgcgagtt    121860
     tgaacatggg ctattaaatt ctccattgaa tttttaaaac atccattatt tacgcagtca    121920
     ttaaaattat tttcaatatc atgattgcct agaccataat aatagggtct ttttaatatt    121980
     ctaagaagtt cgtttatttt atcccactgc cagccatgcc caaaggcagt caaatctccg    122040
     tttatcagca cagatgcatt gggtacagta tccgtataag aattaatatt attgtattgt    122100
     tcacgtatca atgctgctga acgttgttct ttcgtagatt cgttttctgg acgatttgaa    122160
     catggcgata caataggatt attacaattt ggaaatgaga tactatcctg acaatctgtc    122220
     caaggatatt ggggatcaga agtgataact aaagattgta ttaagccaag cggcgcagca    122280
     aaatttaaat ttttttgttg ttttctccac atattatttc ccccacttta ttcatttgtt    122340
     aactattctt aaataagatt agttcttgtg tcaaacaaga tagtgttgat attcctaaaa    122400
     atttaaaaat aagaattaaa tcatttaaag atttcaaatt actttataaa cgaactaaaa    122460
     ataagttgga atattatctt taatggaccc aaaatagcac tcgattaaat aactgtttaa    122520
     tcaatatgtt taaaaaaata taaatattcc tctatttttc gcgcgaaaag atgattagaa    122580
     tggagtgagg agctgtaccc taatcatgtc ataaaaatag ttggtgaggt taaaaatttg    122640
     agaagaggat tacagtatct agcaggaatc taagcggcgt ccctttacaa taattattgt    122700
     gggcattgct ataattcgac tgagaaacac tatatattat ctagctttta acacactgtt    122760
     ttagtcctcc tagactcata ggtgtggttg tattcacata aaggtaaata ccataatcaa    122820
     attagagaat tgcttattat acatggcgtt ttccaatgta ttacgctatc ataaacttct    122880
     tgcctatatt tacttttgcg ttcaaaaaaa tatgttactc gtgcaaatta tcaaaagata    122940
     tcgtcagata gatgtttttg tagttcatca gtaaacaaat gaaattcatc aaaattttat    123000
     cttatattga tagtaatgct ttagtatcta tgatttatca ccatgtcatt tccaaaaaaa    123060
     ttgtacacta aatagtttac aaaaattaaa attactaaat gcttcttttt ataatatatg    123120
     tacttggtat ataagaaaga ttgaagagaa ttagaataaa tttaaaaata tagagataag    123180
     tacagagaat atgaaaaata ctagatacat aattttaacc aatataaatt ttgatgtgca    123240
     atgaaacgtg ttaaagaaaa ggaataaaga cataaagtat tggtgaagtg aaatttaggt    123300
     tctggtgcaa ataatggaca aacgcaaaaa aaggcataga ttccttctgg aatccactcc    123360
     taagcagtta atccaaataa ctgatgaata catctattct gattttgggc agattgtgcc    123420
     cttaatttga gttgaccttt tttgaccata tgcatggctt ctattccagc aatcattttt    123480
     acagctgttt gcatcgattt caaaccaagc atattccgaa ttcgtttttt tataaatcga    123540
     tggtcttgtt caatcatgtt gtttaaatat tttttaaccc gaagtggcat accatatggt    123600
     atgctttttt cattttttaa ttctcgtatc gcaacgggat aggctttatt accatcaaca    123660
     gtgattacac gaggttttgt gacatgaaaa gaagccaagg ctttctttaa aaagcacttg    123720
     gcagccttcg catctcgttt cttactcaaa taaaaatcaa gcgtgtttcc ttcggaatca    123780
     acagcacggt ataagtacat gttttcacct ttgattttga tataggtttc atccactctc    123840
     caagaatcat tcgttcgttt caaatgtttt cgaatccgct catttaattc gggtccatat    123900
     tggtgaaccc aacgcataat ggtggtatgg gacaaagata accctcgttc ttccatcatt    123960
     tccaccaaat cacgaaagct taggttgtac cgcaggtacc agcgtacagt ccacaaaatc    124020
     atgtctgctt gataatgttt ccatttgaat atgttttctt tttccatcct gatcacgcac    124080
     cttttttaag tagtaatacc agtatggcca agtttgaaag aatattttca aatcatttag    124140
     cttttttgca ccagaaccag atggcttcct gccatccctt gttcgaagcc aattcatctc    124200
     ccacctactc acttcgcgtt ccttgaggaa ggagtcttct tggctaaaat gataaataac    124260
     aaccatttct atatatctta ttacagcaaa attttgttgt aaattattaa aattttaaac    124320
     tgaatttacg ctaatctaga tactaaaact cgtacgctga agtttggatt acttctctac    124380
     cttcaaattc gctaaaaaca ttgatttaaa tagtcttttg gttcttttaa aattgttcgg    124440
     acggaagaca tgttttaacc gaacaattta ttaaaggata aagtatacga atagaattgt    124500
     taggacggcc taacaattta tttaaactat cacattatgt aatgccatgt tacacataca    124560
     gaaaatataa tagattattc actgtagcat tgtagattct ttttgtaatc ggttgtgatt    124620
     ttaataaaaa aagcaggtca tttagacctg cttttttaac gttttttaaa tggatttgaa    124680
     gttttaagag tgctaataat attctcttct tcttgttgat tttgtgttga agtagcttca    124740
     ctagtctgac gtttaaatgc agagttttta ccaccactga atcttgatgc cccgccaaat    124800
     ccttggtttt tattataagg attgaatgtg tttttttgaa cacgatttgt tgcaaaagaa    124860
     atatctactt tttcttcgtc ctgtttacgt tgagcttctg ctcttaattg ctcttgtttt    124920
     tcagccaact cttttccttc tcgcgcaaga gatatatagc gtttaggcat tgtcatacca    124980
     gcaaatatag tgtagcaaac cgcatattca ttatcccaaa ttggatctcc aaatttacca    125040
     gcgatttcat ctaatcgttt atactctcct aaggtattac gaattctatt ttccgtatta    125100
     acatctttga agaagtctgc gttagaaggt cttaaaacga aaccaccata cattgttgct    125160
     gtttcaaatt gatgttccgc tgagaagaat ccctcatcta agcttcgttt aatactattt    125220
     tcaagtgaat gtaaatcgaa tttagcaatt ctcgcttttc caattgttaa gaaacgtcct    125280
     ggaatactta atagttttat taaatccgat gggtcatatg taacgttatc agaaccatag    125340
     ttctctggga ttatgtttat ttcatgtaaa gtactcacta cattatcgtt cgcaacttct    125400
     ttccagttta catatctgtt tttcagatct ttcgtgcctt tttgtgactc aattatacgt    125460
     tgcatttgcg tattatcatt aacaattaca tttgctaaag gctttatatc agaatttcca    125520
     aataatctgt cttgctctct cataaattca tcaatttcac ttagtaatac aagtgcattg    125580
     ttaatttcat caggatcacc ggatggtaaa gaaataagca tagatactgg acaagggaaa    125640
     aactgttcac gaattaattg taaaacaagt gaaccccaac ctgttccaac gccaccacca    125700
     gctccaagac aaattaagaa ttggtctaca attacttctc cctcttcatt tgtaaacttt    125760
     cgaccgagct cttgggctaa tttatcaagg tatccattag cattaggatt agtttcaggg    125820
     tcaaataagt cagtaactac agaaggtgta cgtgcagccc cctttaaacc gtcaaaatga    125880
     atacgatctt ctttaataat attttgtaaa tgcatcatat ctgactctgc aaagttaaca    125940
     gctaatgtcg gatagcaagt agttccattc gaaaacttgt aacctgcgaa taaatcagcc    126000
     tctttattac ctttttgacc agcaccaata actccccatc gtatactaat atcatttaca    126060
     ctatggttag ttgaatggat atgttctagt tcattactgt ttaataacat ataaaattcc    126120
     tcccctatac ttataaatta cgcatttcca ttgctttttg tttaaaacac tctactattt    126180
     ctacacctaa atccgataag gtataaatct tagaccttcc taccctagtt tcatcaatat    126240
     atcctgcaca ataaaaacta tttacggttg caaaaacagt cggtttactt agctgtatca    126300
     tttctgccac agccgtttta ttcagcattt gcgcttcacc attttcattg ataaatgcca    126360
     ttaatacttg ataggcacaa tcatcattac caattctttc tgcaatttct gcaatgttta    126420
     acgtataaaa gtgatcccta ttcattgttt aactcccatc tgtttaatta attcttgaga    126480
     gtggaaaaat tcacctaacc tatttatatc acactgggaa tggtatgtaa actgaaagtt    126540
     aaacttaaat ttaaactgtt atttaaacct ttagccacac tagatataca tatatctttc    126600
     tataaccccc agaaatttaa acctaaaatt aaatttaaat ttaaaccgtt atttattttt    126660
     attaaaattc ttctatattt atataaactt aatgtctaaa tttaataatt gtatagattc    126720
     ataggtatta aaaataacat ctttaaaatt attaaaataa aaaagtagca agtccatttt    126780
     tagacttgct acttaaataa accaaactta gaatctagtt caaagtttac tttccaaata    126840
     ttttttgtaa gaatgatttt tttgattctg tcacaattcg ttcttgacgt tcttttcttt    126900
     tttcttgaat taaagtatct ataagatcct gatttctacg tgccacgatt tgctcaagtt    126960
     cttgtttctc ggtcttcagc tcatgcattt gttttaccat ttccacttgt agtttgatac    127020
     tttgatccaa cttttcagtc aaatcttgaa ttaattctgt ttgatattct acttttttct    127080
     ctaggtttgt tttaacctgg tgttcttcta atgctactgg tagctcgtca ccatttaacc    127140
     aagagcgaac tttcttatag ctccaatttt gttcttggat cttcttctta atagatataa    127200
     acttattaat gtcatcttcc gtgtagcgac gatgcccacc attagttcta tttatttgta    127260
     gattaaactc ttcctcgtaa actcttaata agtcattcga aagcccagta agttcagata    127320
     cttctttcat tttatactca ttttgttctt cgtttgtttt actctcactc atagaaacaa    127380
     cacctcctta caaccgaaaa acttagaaaa tctcttccat gttatattct acatagaatg    127440
     ggcattatct tcctatagat tactctacca tagaaaaact agaaaatctt aatataattt    127500
     cactaaaaat ctagtatttt tatgtctata gattacattg tttatctata gtattctaca    127560
     ttctaatatt cattctactt ttatatatct tctatatggt tatttagcaa aacttagata    127620
     agattaaatg aagaaaaaca ttgatgtatc aaggtttttt ggaaagttag aatgaactta    127680
     tgctaattta tgttccaact tactaaatta aacttaccgg ttatttcttc aagtttttct    127740
     tcttaaattg tactctcgtc cactaaaaat aattttcctt gagtattata aaattgtgga    127800
     aaacgaatag gaaaatatat ctatacattt aaattaatta aaacatagta caaaatttag    127860
     ctattaatag aaaatatata gagttatttt tttgtatata tagtgattca taggcggcaa    127920
     caa                                                                  127923
//