Dbfetch

ID   Y16639; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   Y16639;
XX
DT   11-OCT-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I HLA B exon 3, individual 18543
XX
KW   HLA class I antigen; HLA-B gene; human leukocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   van den Berg-Loonen E.;
RT   ;
RL   Submitted (20-FEB-1998) to the INSDC.
RL   E. van den Berg-Loonen, Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS
XX
RN   [3]
RX   DOI; 10.1034/j.1399-0039.2000.560408.x.
RX   PUBMED; 11098936.
RA   Voorter C., van der Vlies S., van den Berg-Loonen E.;
RT   "Sequence-based typing of HLA-B: the B7 cross-reacting group";
RL   Tissue Antigens 56(4):356-362(0).
XX
DR   MD5; 31d4f0100d6385a32d5c4b90c46bcca2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="18543"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="HLA class I"
FT                   /db_xref="IMGT/HLA:B*40:10:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GJ11"
FT                   /protein_id="CAC12864.1"
FT                   /translation="SHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 276 BP; 53 A; 85 C; 101 G; 37 T; 0 other;
     ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatctccca gcgcaagttg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggac aagctggagc gcgctg                                 276
//