spacer

EBI Dbfetch

ID   X55711; SV 1; linear; genomic DNA; STD; HUM; 3840 BP.
XX
AC   X55711;
XX
DT   28-NOV-1990 (Rel. 26, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   H.sapiens HLA-Bw57 gene
XX
KW   HLA-Bw57 gene; immunoglobulin; major histocompatibility complex;
KW   signal peptide.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3840
RA   Girdlestone J.;
RT   ;
RL   Submitted (01-OCT-1990) to the INSDC.
RL   Girdlestone J., Medical Research Council Lab. of Mol. Biology, Hills Road ,
RL   Cambridge CB2 2QH, UK.
XX
RN   [2]
RP   1-3840
RX   DOI; 10.1093/nar/18.22.6702.
RX   PUBMED; 2251138.
RA   Isamat M., Girdlestone J., Milstein C.;
RT   "Nucleotide sequence of an HLA-Bw57 gene";
RL   Nucleic Acids Res. 18(22):6702-6702(1990).
XX
DR   MD5; fddd7618038b2c22117e6e7e05865fce.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3840
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="lambda 2001."
FT                   /cell_line="MOLT4"
FT                   /cell_type="thymoma"
FT                   /db_xref="taxon:9606"
FT   CAAT_signal     444..448
FT   TATA_signal     470..474
FT   CDS             join(521..593,722..991,1238..1513,2089..2364,2469..2585,
FT                   3027..3059,3166..3209)
FT                   /gene="HLA-Bw57"
FT                   /db_xref="GOA:P18465"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*57:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:2BVO"
FT                   /db_xref="PDB:2BVP"
FT                   /db_xref="PDB:2BVQ"
FT                   /db_xref="PDB:2HJL"
FT                   /db_xref="PDB:2RFX"
FT                   /db_xref="PDB:2YPK"
FT                   /db_xref="PDB:2YPL"
FT                   /db_xref="PDB:3UPR"
FT                   /db_xref="PDB:3VH8"
FT                   /db_xref="PDB:3VRI"
FT                   /db_xref="PDB:3VRJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18465"
FT                   /protein_id="CAA39244.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRI
FT                   ALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   mRNA            join(<521..593,722..991,1238..1513,2089..2364,2469..2585,
FT                   3027..3059,3166..3213,3397..>3801)
FT   exon            <521..593
FT                   /number=1
FT   prim_transcript <521..>3840
FT   intron          595..722
FT                   /number=1
FT   exon            722..991
FT                   /number=2
FT                   /note="alpha 1"
FT   intron          992..1237
FT                   /number=2
FT   exon            1238..1513
FT                   /number=3
FT                   /note="alpha 2"
FT   intron          1514..2088
FT                   /number=3
FT   exon            2089..2364
FT                   /number=4
FT                   /note="alpha 3"
FT   intron          2365..2468
FT                   /number=4
FT   exon            2469..2585
FT                   /number=5
FT                   /note="alpha 4"
FT   intron          2586..3026
FT                   /number=5
FT   exon            3027..3059
FT                   /number=6
FT                   /note="alpha 5"
FT   intron          3060..3165
FT                   /number=6
FT   exon            3166..3209
FT                   /number=7
FT                   /note="alpha 7"
FT   intron          3214..3396
FT                   /number=7
FT   exon            3397..>3801
FT                   /number=8
FT                   /note="untranslated exon"
XX
SQ   Sequence 3840 BP; 741 A; 1079 C; 1191 G; 829 T; 0 other;
     gagctcactc tctggcatca agttctccgt gatcagtttc cctacacaag atccaagagg        60
     agaggtaagg agtgagaggc agggagtcca gttcagggac agggattcca ggaggagaag       120
     tgaaggggaa gcgggtgggc gctcagcctg ggggtctctc cctggtttcc acagacagat       180
     ccttgtgcag gactcaggca gacagtgtga caaagaggct ggtgtaggag aagagggatc       240
     aggacgaagt cccaggtccc ggacggggct ctcagggtct caggctccga gagccttgtc       300
     tgcattgggg aggcgcagcg ttggggattc cccactccca cgagtttcac ttcttctccc       360
     aacctgtgtc gggtccttct tccaggatac tcgtgacgcg tccccatttc ccactcccat       420
     tgggtgtcgg gtgtctagag aagccaatca gcgtcgccgc ggtcccagtt ctaaagtccc       480
     cacgcaccca cccggactca gaatctcctc agacgccgag atgcgggtca cggcaccccg       540
     aaccgtcctc ctgctgctct ggggggcagt ggccctgacc gagacctggg ccggtgagtg       600
     cgggtcggca gggaaatggc ctctgtaggg aggagcaagg ggaccgcagg cgggggcgca       660
     ggacccgggg agccgcgccg ggaggagggt cgggcgggtc tcagcccctc ctcgccccca       720
     ggctcccact ccatgaggta tttctacacc gccatgtccc ggcccggccg cggggagccc       780
     cgcttcatcg cagtgggcta cgtggacgac acccagttcg tgaggttcga cagcgacgcc       840
     gcgagtccga ggatggcgcc ccgggcgcca tggatagagc aggaggggcc ggagtattgg       900
     gacggggaga cacggaacat gaaggcctcc gcgcagactt accgagagaa cctgcggatc       960
     gcgctccgct actacaacca gagcgaggcc ggtgagtgac cccggcccgg ggcgcaggtc      1020
     acgactcccc atcccccacg tacggcccgg gtcgccccga gtctccgggt ccgagatcca      1080
     cccccctgag gccgcgggac ccgcccagac cctcgaccgg cgagagcccc aggcgcgttt      1140
     acccggtttc attttcagtt gaggccaaaa tccccgcggg ttggtcaggg cggggcgggg      1200
     ctcgggggga cggggctgac cgcggggccg gggccagggt ctcacatcat ccaggtgatg      1260
     tatggctgcg acgtggggcc ggacgggcgc ctcctccgcg ggcatgacca gtccgcctac      1320
     gacggcaagg attacatcgc cctgaacgag gacctgagct cctggaccgc ggcggacacg      1380
     gcggctcaga tcacccagcg caagtgggag gcggcccgtg tggcggagca gctgagagcc      1440
     tacctggagg gcctgtgcgt ggagtggctc cgcagatacc tggagaacgg gaaggagacg      1500
     ctgcagcgcg cgggtaccag gggcagtggg gagccttccc catctcctat aggtcgccgg      1560
     ggatggcctc ccacgagaag aggaggaaaa tgggatcagc gctagaatgt cgccctccct      1620
     tgaatggaga atggcatgag ttttcctgag tttcctctga gggccccctc ttctctctag      1680
     gacaattaag ggatgacgtc tctgaggaaa tggaggggaa gacagtccct agaatactga      1740
     tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc gtgacttttc ctctcaggcc      1800
     ttgttctctg cctcacactc agtgtgtttg gggctctgat tccagcactt ctgagtcact      1860
     ttacctccac tcagatcagg agcagaagtc cctgttcccc gctcagagac tcgaactttc      1920
     caatgaatag gagattatcc caggtgcctg cgtccaggct ggtgtctggg ttctgtgccc      1980
     cttccccacc ccaggtgtcc tgcccattct caggctggtc acatgggtgg tcctagggtg      2040
     tcccatgaga gatgcaaagc gcctgaattt tctgactctt cccatcagac cccccaaaga      2100
     cacatgtgac ccaccacccc atctctgacc atgaggccac cctgaggtgc tgggccctgg      2160
     gcttctaccc tgcggagatc acactgacct ggcagcggga tggcgaggac caaactcagg      2220
     acaccgagct tgtggagacc agaccagcag gagatagaac cttccagaag tgggcagctg      2280
     tggtggtgcc ttctggagaa gagcagagat acacatgcca tgtacagcat gaggggctgc      2340
     caaagcccct caccctgaga tggggtaagg agggggatga ggggtcatat ctcttctcag      2400
     ggaaagcagg agcccttctg gagcccttca gcagggtcag ggcccctcat cttcccctcc      2460
     tttcccagag ccatcttccc aatccaccgt ccccatcgtg ggcattgttg ctggcctggc      2520
     tgtcctagca gttgtggtca tcggagctgt ggtcgctgct gtgatgtgta ggaggaagag      2580
     ctcaggtagg gaaggggtga ggggtggggt ctgggttttc ttgtcccact gggggtttca      2640
     agccccaggt agaagtgttc cctgcctcat tactgggaag cagcatgcac acaggggcta      2700
     acgcagcctg ggaccctgtg tgccagcact tactcttttg tgcagcacat gtgacaatga      2760
     aggacggatg tatcacctcg atggttgtgg tgttggggtc ctgattccag cattcatgag      2820
     tcaggggaag gtccctgcta aggacagacc ttaggagagc agttggtcca ggacccacac      2880
     ttgctttcct cgtgtttcct gatcctgccc tgggtctgta gtcatacttc tggaaattcc      2940
     ttttgggtcc aagacgagga ggttcctcta agatctcatg gccctgcttc ctcccagtcc      3000
     cctcacagga cattttcttc ccacaggtgg aaaaggaggg agctactctc aggctgcgtg      3060
     taagtggtgg gggtgggagt gtggaggagc tcacccaccc cataattcct cctgtcccac      3120
     gtctcctgcg ggctctgacc aggtcctgtt tttgttctac tccaggcagc gacagtgccc      3180
     agggctctga tgtgtctctc acagcttgaa aaggtgagat tcttggggtc tagagtgggt      3240
     gggggtggcg ggtctggggc ggggtggggc agaggggaaa ggcctgggta atggagattc      3300
     tttgattggg atgtttcgcg tgtgtggtgg gctgttcaga gtgtcatcac ttaccatgac      3360
     tcaccagaat ttgttcatga ctgttgtttt ctgtagcctg agacagctgt cttgtgaggg      3420
     actgagatgc aggatttctt cacgcctccc ctttgtgact tcaagagcct ctggcatctc      3480
     tttctgcaaa ggcacctgaa tgtgtctgcg tccctgttag cctaatgtga ggaggtggag      3540
     agacagccca accttgtgtc cactgtgacc cctgttccca tgctgacctg tgtttcctcc      3600
     ccagtcatct ttcttgttcc agagaggtgg ggctggatgt ctccatctct gtctcaactt      3660
     tatgtgcact gagctgcaac ttcttacttc cctgctgaaa ataagaatct gaatatcaat      3720
     ttgttttctc aaatatttgc tatgagaggt tgatggatta attaaataag tcaattcctg      3780
     gaatttgaga gagcaaataa agacctgaga accttccaga atctgcatgt tcgctgtgct      3840
//


spacer
spacer