spacer

EBI Dbfetch

ID   X03158; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   X03158;
XX
DT   02-JUL-1986 (Rel. 09, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human gene fragment for HLA-Aw69 class I antigen (exon 2-3)
XX
KW   class I antigen; glycoprotein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RX   PUBMED; 3877632.
RA   Holmes N.;
RT   "Exon shuffling in vivo can generate novel HLA class I molecules";
RL   EMBO J. 4(11):2849-2854(1985).
XX
RN   [2]
RP   1-787
RA   Salter R.;
RT   ;
RL   Submitted (13-AUG-1986) to the INSDC.
XX
DR   MD5; 370c82d3aa8cbac605f668addbc498f8.
XX
CC   The author suggests that the HLA-Aw69 gene results from a single
CC   recombination event between allelic HLA-A2 and HLA-Aw68 genes (see
CC   X03070, X03071). The putative recombination point is found between
CC   positions 220 and 306.
CC   
CC   Data kindly reviewed (13-AUG-1986) by Salter R.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /strain="IDF, BJ and ZM cell lines"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="human leucocyte antigen A"
FT                   /note="HLA-Aw69"
FT                   /db_xref="GOA:P10316"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*69:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10316"
FT                   /protein_id="CAB56607.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT   intron          271..511
FT                   /gene="HLA-A"
FT                   /number=2
FT   old_sequence    451..454
FT                   /note="ccag was cagg in [1]"
FT                   /citation=[1]
FT   old_sequence    493..496
FT                   /note="accg was acgt in [1]"
FT                   /citation=[1]
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 787 BP; 144 A; 251 C; 281 G; 111 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacctctca tcccccacgg acgggccagg tcgcccacag tctccgggtc cgagatccgc       360
     cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc ctttacccgg       420
     tttcattttc agtttaggcc aaaaatcccc cagggttggt cggggcgggg cggggctcgg       480
     gggaccgggc tgaccgcggg gtccgggcca ggttctcaca ccgtccagag gatgtatggc       540
     tgcgacgtgg ggtcggactg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagaccacca agcacaagtg ggaggcggcc catgtggcgg agcagttgag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer