Dbfetch
ID U03863; SV 1; linear; unassigned DNA; STD; HUM; 1098 BP. XX AC U03863; XX DT 05-DEC-1993 (Rel. 38, Created) DT 17-JUN-2008 (Rel. 96, Last updated, Version 5) XX DE Human MHC Class I HLA-A-0203 mRNA, complete cds. XX KW Human MHC, Class I, HLA-A-0203. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-1098 RX PUBMED; 3496393. RA Holmes N., Ennis P., Wan A.M., Denney D.W., Parham P.; RT "Multiple genetic mechanisms have contributed to the generation of the RT HLA-A2/A28 family of class I MHC molecules"; RL J. Immunol. 139(3):936-941(1987). XX RN [2] RP 1-1098 RA Domena J.D.; RT ; RL Submitted (30-NOV-1993) to the INSDC. RL John D. Domena Ph.D., Department of Cell Biology, Stanford University, RL Sherman Fairchild Bldg., Stanford, CA 94305-5400, USA XX DR MD5; 1d45c7ffd91556b22bdae0c134a3a271. DR Ensembl-Gn; ENSG00000235657; homo_sapiens. DR Ensembl-Tr; ENST00000457879; homo_sapiens. DR Ensembl-Tr; ENST00000547271; homo_sapiens. DR IMGT/HLA; HLA-A*02:03:01; HLA00008. XX FH Key Location/Qualifiers FH FT source 1..1098 FT /organism="Homo sapiens" FT /chromosome="6" FT /map="6p21.3" FT /mol_type="unassigned DNA" FT /haplotype="HLA A2.3/33; B40/44" FT /cell_line="DK1" FT /cell_type="ebv transformed lymphocytes" FT /db_xref="taxon:9606" FT CDS 1..1098 FT /codon_start=1 FT /gene="HLA-A-0203" FT /db_xref="GOA:P01892" FT /db_xref="HGNC:HGNC:4931" FT /db_xref="InterPro:IPR001039" FT /db_xref="InterPro:IPR003006" FT /db_xref="InterPro:IPR003597" FT /db_xref="InterPro:IPR007110" FT /db_xref="InterPro:IPR010579" FT /db_xref="InterPro:IPR011161" FT /db_xref="InterPro:IPR011162" FT /db_xref="InterPro:IPR013783" FT /db_xref="InterPro:IPR036179" FT /db_xref="InterPro:IPR037055" FT /db_xref="PDB:1AKJ" FT /db_xref="PDB:1AO7" FT /db_xref="PDB:1AQD" FT /db_xref="PDB:1B0G" FT /db_xref="PDB:1B0R" FT /db_xref="PDB:1BD2" FT /db_xref="PDB:1DUY" FT /db_xref="PDB:1DUZ" FT /db_xref="PDB:1EEY" FT /db_xref="PDB:1EEZ" FT /db_xref="PDB:1HHG" FT /db_xref="PDB:1HHH" FT /db_xref="PDB:1HHI" FT /db_xref="PDB:1HHJ" FT /db_xref="PDB:1HHK" FT /db_xref="PDB:1HLA" FT /db_xref="PDB:1I1F" FT /db_xref="PDB:1I1Y" FT /db_xref="PDB:1I4F" FT /db_xref="PDB:1I7R" FT /db_xref="PDB:1I7T" FT /db_xref="PDB:1I7U" FT /db_xref="PDB:1IM3" FT /db_xref="PDB:1JF1" FT /db_xref="PDB:1JHT" FT /db_xref="PDB:1LP9" FT /db_xref="PDB:1OGA" FT /db_xref="PDB:1P7Q" FT /db_xref="PDB:1QEW" FT /db_xref="PDB:1QR1" FT /db_xref="PDB:1QRN" FT /db_xref="PDB:1QSE" FT /db_xref="PDB:1QSF" FT /db_xref="PDB:1S8D" FT /db_xref="PDB:1S9W" FT /db_xref="PDB:1S9X" FT /db_xref="PDB:1S9Y" FT /db_xref="PDB:1T1W" FT /db_xref="PDB:1T1X" FT /db_xref="PDB:1T1Y" FT /db_xref="PDB:1T1Z" FT /db_xref="PDB:1T20" FT /db_xref="PDB:1T21" FT /db_xref="PDB:1T22" FT /db_xref="PDB:1TVB" FT /db_xref="PDB:1TVH" FT /db_xref="PDB:1UR7" FT /db_xref="PDB:2AV1" FT /db_xref="PDB:2AV7" FT /db_xref="PDB:2BNQ" FT /db_xref="PDB:2BNR" FT /db_xref="PDB:2C7U" FT /db_xref="PDB:2CLR" FT /db_xref="PDB:2F53" FT /db_xref="PDB:2F54" FT /db_xref="PDB:2GIT" FT /db_xref="PDB:2GJ6" FT /db_xref="PDB:2GT9" FT /db_xref="PDB:2GTW" FT /db_xref="PDB:2GTZ" FT /db_xref="PDB:2GUO" FT /db_xref="PDB:2J8U" FT /db_xref="PDB:2JCC" FT /db_xref="PDB:2P5E" FT /db_xref="PDB:2P5W" FT /db_xref="PDB:2PYE" FT /db_xref="PDB:2UWE" FT /db_xref="PDB:2V2W" FT /db_xref="PDB:2V2X" FT /db_xref="PDB:2VLJ" FT /db_xref="PDB:2VLK" FT /db_xref="PDB:2VLL" FT /db_xref="PDB:2VLR" FT /db_xref="PDB:2X4N" FT /db_xref="PDB:2X4O" FT /db_xref="PDB:2X4P" FT /db_xref="PDB:2X4Q" FT /db_xref="PDB:2X4R" FT /db_xref="PDB:2X4S" FT /db_xref="PDB:2X4T" FT /db_xref="PDB:2X4U" FT /db_xref="PDB:2X70" FT /db_xref="PDB:3BGM" FT /db_xref="PDB:3BH8" FT /db_xref="PDB:3BH9" FT /db_xref="PDB:3BHB" FT /db_xref="PDB:3D25" FT /db_xref="PDB:3D39" FT /db_xref="PDB:3D3V" FT /db_xref="PDB:3FQN" FT /db_xref="PDB:3FQR" FT /db_xref="PDB:3FQT" FT /db_xref="PDB:3FQU" FT /db_xref="PDB:3FQW" FT /db_xref="PDB:3FQX" FT /db_xref="PDB:3FT2" FT /db_xref="PDB:3FT3" FT /db_xref="PDB:3FT4" FT /db_xref="PDB:3GIV" FT /db_xref="PDB:3GJF" FT /db_xref="PDB:3GSN" FT /db_xref="PDB:3GSO" FT /db_xref="PDB:3GSQ" FT /db_xref="PDB:3GSR" FT /db_xref="PDB:3GSU" FT /db_xref="PDB:3GSV" FT /db_xref="PDB:3GSW" FT /db_xref="PDB:3GSX" FT /db_xref="PDB:3H7B" FT /db_xref="PDB:3H9H" FT /db_xref="PDB:3H9S" FT /db_xref="PDB:3HAE" FT /db_xref="PDB:3HLA" FT /db_xref="PDB:3HPJ" FT /db_xref="PDB:3I6G" FT /db_xref="PDB:3I6K" FT /db_xref="PDB:3IXA" FT /db_xref="PDB:3KLA" FT /db_xref="PDB:3MGO" FT /db_xref="PDB:3MGT" FT /db_xref="PDB:3MR9" FT /db_xref="PDB:3MRB" FT /db_xref="PDB:3MRC" FT /db_xref="PDB:3MRD" FT /db_xref="PDB:3MRE" FT /db_xref="PDB:3MRF" FT /db_xref="PDB:3MRG" FT /db_xref="PDB:3MRH" FT /db_xref="PDB:3MRI" FT /db_xref="PDB:3MRJ" FT /db_xref="PDB:3MRK" FT /db_xref="PDB:3MRL" FT /db_xref="PDB:3MRM" FT /db_xref="PDB:3MRN" FT /db_xref="PDB:3MRO" FT /db_xref="PDB:3MRP" FT /db_xref="PDB:3MRQ" FT /db_xref="PDB:3MRR" FT /db_xref="PDB:3MYJ" FT /db_xref="PDB:3O3A" FT /db_xref="PDB:3O3B" FT /db_xref="PDB:3O3D" FT /db_xref="PDB:3O3E" FT /db_xref="PDB:3O4L" FT /db_xref="PDB:3PWJ" FT /db_xref="PDB:3PWL" FT /db_xref="PDB:3PWN" FT /db_xref="PDB:3PWP" FT /db_xref="PDB:3QDG" FT /db_xref="PDB:3QDJ" FT /db_xref="PDB:3QDM" FT /db_xref="PDB:3QEQ" FT /db_xref="PDB:3QFD" FT /db_xref="PDB:3QFJ" FT /db_xref="PDB:3REW" FT /db_xref="PDB:3TO2" FT /db_xref="PDB:3UTQ" FT /db_xref="PDB:3UTS" FT /db_xref="PDB:3UTT" FT /db_xref="PDB:3V5D" FT /db_xref="PDB:3V5H" FT /db_xref="PDB:3V5K" FT /db_xref="PDB:4E5X" FT /db_xref="PDB:4EMZ" FT /db_xref="PDB:4EN2" FT /db_xref="PDB:4EUP" FT /db_xref="PDB:4FTV" FT /db_xref="PDB:4GKN" FT /db_xref="PDB:4GKS" FT /db_xref="PDB:4I4W" FT /db_xref="PDB:4JFD" FT /db_xref="PDB:4JFE" FT /db_xref="PDB:4JFF" FT /db_xref="PDB:4JFO" FT /db_xref="PDB:4JFP" FT /db_xref="PDB:4JFQ" FT /db_xref="PDB:4K7F" FT /db_xref="PDB:4L29" FT /db_xref="PDB:4L3C" FT /db_xref="PDB:4L3E" FT /db_xref="PDB:4MNQ" FT /db_xref="PDB:4NNX" FT /db_xref="PDB:4NNY" FT /db_xref="PDB:4NO0" FT /db_xref="PDB:4NO2" FT /db_xref="PDB:4NO3" FT /db_xref="PDB:4NO5" FT /db_xref="PDB:4OV5" FT /db_xref="PDB:4QOK" FT /db_xref="PDB:4U6X" FT /db_xref="PDB:4U6Y" FT /db_xref="PDB:4UQ3" FT /db_xref="PDB:4WJ5" FT /db_xref="PDB:4WUU" FT /db_xref="PDB:5C07" FT /db_xref="PDB:5C08" FT /db_xref="PDB:5C09" FT /db_xref="PDB:5C0A" FT /db_xref="PDB:5C0B" FT /db_xref="PDB:5C0C" FT /db_xref="PDB:5C0D" FT /db_xref="PDB:5C0E" FT /db_xref="PDB:5C0F" FT /db_xref="PDB:5C0G" FT /db_xref="PDB:5C0I" FT /db_xref="PDB:5C0J" FT /db_xref="PDB:5D2L" FT /db_xref="PDB:5D2N" FT /db_xref="PDB:5D9S" FT /db_xref="PDB:5DDH" FT /db_xref="PDB:5E00" FT /db_xref="PDB:5E6I" FT /db_xref="PDB:5E9D" FT /db_xref="PDB:5ENW" FT /db_xref="PDB:5EOT" FT /db_xref="PDB:5EU3" FT /db_xref="PDB:5EU4" FT /db_xref="PDB:5EU5" FT /db_xref="PDB:5EU6" FT /db_xref="PDB:5EUO" FT /db_xref="PDB:5F7D" FT /db_xref="PDB:5F9J" FT /db_xref="PDB:5FA3" FT /db_xref="PDB:5FA4" FT /db_xref="PDB:5FDW" FT /db_xref="PDB:5HHM" FT /db_xref="PDB:5HHN" FT /db_xref="PDB:5HHO" FT /db_xref="PDB:5HHP" FT /db_xref="PDB:5HHQ" FT /db_xref="PDB:5HYJ" FT /db_xref="PDB:5IRO" FT /db_xref="PDB:5ISZ" FT /db_xref="PDB:5JHD" FT /db_xref="PDB:5JZI" FT /db_xref="PDB:5MEN" FT /db_xref="PDB:5MEO" FT /db_xref="PDB:5MEP" FT /db_xref="PDB:5MEQ" FT /db_xref="PDB:5MER" FT /db_xref="PDB:5N1Y" FT /db_xref="PDB:5N6B" FT /db_xref="PDB:5NHT" FT /db_xref="PDB:5NME" FT /db_xref="PDB:5NMF" FT /db_xref="PDB:5NMG" FT /db_xref="PDB:5NMH" FT /db_xref="PDB:5NMK" FT /db_xref="PDB:5NQK" FT /db_xref="PDB:5SWQ" FT /db_xref="PDB:5TEZ" FT /db_xref="PDB:5W1W" FT /db_xref="PDB:5WSH" FT /db_xref="PDB:5YXN" FT /db_xref="PDB:5YXU" FT /db_xref="PDB:6AM5" FT /db_xref="PDB:6AMT" FT /db_xref="PDB:6AMU" FT /db_xref="PDB:6APN" FT /db_xref="PDB:6D78" FT /db_xref="PDB:6D7G" FT /db_xref="PDB:6DKP" FT /db_xref="PDB:6EQA" FT /db_xref="PDB:6EQB" FT /db_xref="PDB:6EWA" FT /db_xref="PDB:6EWC" FT /db_xref="PDB:6EWO" FT /db_xref="PDB:6G3J" FT /db_xref="UniProtKB/Swiss-Prot:P01892" FT /protein_id="AAA03604.1" FT /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR FT FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT FT LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA FT AQTTKHKWETAHEAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE FT ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY FT TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK FT GGSYSQAASSDSAQGSDVSLTACKV" FT exon 1..73 FT exon 74..343 FT exon 344..619 FT exon 620..895 FT exon 896..1021 FT exon 1022..1054 FT exon 1055..1098 XX SQ Sequence 1098 BP; 222 A; 323 C; 368 G; 185 T; 0 other; atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggctct ggccctgacc 60 cagacctggg cgggctctca ctccatgagg tatttcttca catccgtgtc ccggcccggc 120 cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc 180 gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggt 240 ccggagtatt gggacgggga gacacggaaa gtgaaggccc actcacagac tcaccgagtg 300 gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccgtccag 360 aggatgtatg gctgcgacgt ggggtcggac tggcgcttcc tccgcgggta ccaccagtac 420 gcctacgacg gcaaggatta catcgccctg aaagaggacc tgcgctcttg gaccgcggcg 480 gacatggcag ctcagaccac caagcacaag tgggagacgg cccatgaggc ggagcagtgg 540 agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag 600 gagacgctgc agcgcacgga cgcccccaaa acgcatatga ctcaccacgc tgtctctgac 660 catgaagcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc 720 tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca 780 ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaca ggagcagaga 840 tacacctgcc atgtgcagca tgagggtttg cccaagcccc tcaccctgag atgggagccg 900 tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct 960 gtgatcactg gagctgtggt cgctgctgtg atgtggagga ggaagagctc agatagaaaa 1020 ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc 1080 acagcttgta aagtgtga 1098 //