spacer

EBI Dbfetch

ID   U03863; SV 1; linear; unassigned DNA; STD; HUM; 1098 BP.
XX
AC   U03863;
XX
DT   05-DEC-1993 (Rel. 38, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC Class I HLA-A-0203 mRNA, complete cds.
XX
KW   Human MHC, Class I, HLA-A-0203.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   PUBMED; 3496393.
RA   Holmes N., Ennis P., Wan A.M., Denney D.W., Parham P.;
RT   "Multiple genetic mechanisms have contributed to the generation of the
RT   HLA-A2/A28 family of class I MHC molecules";
RL   J. Immunol. 139(3):936-941(1987).
XX
RN   [2]
RP   1-1098
RA   Domena J.D.;
RT   ;
RL   Submitted (30-NOV-1993) to the INSDC.
RL   John D. Domena Ph.D., Department of Cell Biology, Stanford University,
RL   Sherman Fairchild Bldg., Stanford, CA 94305-5400, USA
XX
DR   MD5; 1d45c7ffd91556b22bdae0c134a3a271.
DR   Ensembl-Gn; ENSG00000235657; homo_sapiens.
DR   Ensembl-Tr; ENST00000457879; homo_sapiens.
DR   Ensembl-Tr; ENST00000547271; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="unassigned DNA"
FT                   /haplotype="HLA A2.3/33; B40/44"
FT                   /cell_line="DK1"
FT                   /cell_type="ebv transformed lymphocytes"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /codon_start=1
FT                   /gene="HLA-A-0203"
FT                   /db_xref="GOA:P01892"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*02:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1AKJ"
FT                   /db_xref="PDB:1AO7"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1B0G"
FT                   /db_xref="PDB:1B0R"
FT                   /db_xref="PDB:1BD2"
FT                   /db_xref="PDB:1DUY"
FT                   /db_xref="PDB:1DUZ"
FT                   /db_xref="PDB:1EEY"
FT                   /db_xref="PDB:1EEZ"
FT                   /db_xref="PDB:1HHG"
FT                   /db_xref="PDB:1HHH"
FT                   /db_xref="PDB:1HHI"
FT                   /db_xref="PDB:1HHJ"
FT                   /db_xref="PDB:1HHK"
FT                   /db_xref="PDB:1HLA"
FT                   /db_xref="PDB:1I1F"
FT                   /db_xref="PDB:1I1Y"
FT                   /db_xref="PDB:1I4F"
FT                   /db_xref="PDB:1I7R"
FT                   /db_xref="PDB:1I7T"
FT                   /db_xref="PDB:1I7U"
FT                   /db_xref="PDB:1IM3"
FT                   /db_xref="PDB:1JF1"
FT                   /db_xref="PDB:1JHT"
FT                   /db_xref="PDB:1LP9"
FT                   /db_xref="PDB:1OGA"
FT                   /db_xref="PDB:1P7Q"
FT                   /db_xref="PDB:1QEW"
FT                   /db_xref="PDB:1QR1"
FT                   /db_xref="PDB:1QRN"
FT                   /db_xref="PDB:1QSE"
FT                   /db_xref="PDB:1QSF"
FT                   /db_xref="PDB:1S8D"
FT                   /db_xref="PDB:1S9W"
FT                   /db_xref="PDB:1S9X"
FT                   /db_xref="PDB:1S9Y"
FT                   /db_xref="PDB:1T1W"
FT                   /db_xref="PDB:1T1X"
FT                   /db_xref="PDB:1T1Y"
FT                   /db_xref="PDB:1T1Z"
FT                   /db_xref="PDB:1T20"
FT                   /db_xref="PDB:1T21"
FT                   /db_xref="PDB:1T22"
FT                   /db_xref="PDB:1TVB"
FT                   /db_xref="PDB:1TVH"
FT                   /db_xref="PDB:1UR7"
FT                   /db_xref="PDB:2AV1"
FT                   /db_xref="PDB:2AV7"
FT                   /db_xref="PDB:2BNQ"
FT                   /db_xref="PDB:2BNR"
FT                   /db_xref="PDB:2C7U"
FT                   /db_xref="PDB:2CLR"
FT                   /db_xref="PDB:2F53"
FT                   /db_xref="PDB:2F54"
FT                   /db_xref="PDB:2GIT"
FT                   /db_xref="PDB:2GJ6"
FT                   /db_xref="PDB:2GT9"
FT                   /db_xref="PDB:2GTW"
FT                   /db_xref="PDB:2GTZ"
FT                   /db_xref="PDB:2GUO"
FT                   /db_xref="PDB:2J8U"
FT                   /db_xref="PDB:2JCC"
FT                   /db_xref="PDB:2P5E"
FT                   /db_xref="PDB:2P5W"
FT                   /db_xref="PDB:2PYE"
FT                   /db_xref="PDB:2UWE"
FT                   /db_xref="PDB:2V2W"
FT                   /db_xref="PDB:2V2X"
FT                   /db_xref="PDB:2VLJ"
FT                   /db_xref="PDB:2VLK"
FT                   /db_xref="PDB:2VLL"
FT                   /db_xref="PDB:2VLR"
FT                   /db_xref="PDB:2X4N"
FT                   /db_xref="PDB:2X4O"
FT                   /db_xref="PDB:2X4P"
FT                   /db_xref="PDB:2X4Q"
FT                   /db_xref="PDB:2X4R"
FT                   /db_xref="PDB:2X4S"
FT                   /db_xref="PDB:2X4T"
FT                   /db_xref="PDB:2X4U"
FT                   /db_xref="PDB:2X70"
FT                   /db_xref="PDB:3BGM"
FT                   /db_xref="PDB:3BH8"
FT                   /db_xref="PDB:3BH9"
FT                   /db_xref="PDB:3BHB"
FT                   /db_xref="PDB:3D25"
FT                   /db_xref="PDB:3D39"
FT                   /db_xref="PDB:3D3V"
FT                   /db_xref="PDB:3FQN"
FT                   /db_xref="PDB:3FQR"
FT                   /db_xref="PDB:3FQT"
FT                   /db_xref="PDB:3FQU"
FT                   /db_xref="PDB:3FQW"
FT                   /db_xref="PDB:3FQX"
FT                   /db_xref="PDB:3FT2"
FT                   /db_xref="PDB:3FT3"
FT                   /db_xref="PDB:3FT4"
FT                   /db_xref="PDB:3GIV"
FT                   /db_xref="PDB:3GJF"
FT                   /db_xref="PDB:3GSN"
FT                   /db_xref="PDB:3GSO"
FT                   /db_xref="PDB:3GSQ"
FT                   /db_xref="PDB:3GSR"
FT                   /db_xref="PDB:3GSU"
FT                   /db_xref="PDB:3GSV"
FT                   /db_xref="PDB:3GSW"
FT                   /db_xref="PDB:3GSX"
FT                   /db_xref="PDB:3H7B"
FT                   /db_xref="PDB:3H9H"
FT                   /db_xref="PDB:3H9S"
FT                   /db_xref="PDB:3HAE"
FT                   /db_xref="PDB:3HLA"
FT                   /db_xref="PDB:3HPJ"
FT                   /db_xref="PDB:3I6G"
FT                   /db_xref="PDB:3I6K"
FT                   /db_xref="PDB:3IXA"
FT                   /db_xref="PDB:3KLA"
FT                   /db_xref="PDB:3MGO"
FT                   /db_xref="PDB:3MGT"
FT                   /db_xref="PDB:3MR9"
FT                   /db_xref="PDB:3MRB"
FT                   /db_xref="PDB:3MRC"
FT                   /db_xref="PDB:3MRD"
FT                   /db_xref="PDB:3MRE"
FT                   /db_xref="PDB:3MRF"
FT                   /db_xref="PDB:3MRG"
FT                   /db_xref="PDB:3MRH"
FT                   /db_xref="PDB:3MRI"
FT                   /db_xref="PDB:3MRJ"
FT                   /db_xref="PDB:3MRK"
FT                   /db_xref="PDB:3MRL"
FT                   /db_xref="PDB:3MRM"
FT                   /db_xref="PDB:3MRN"
FT                   /db_xref="PDB:3MRO"
FT                   /db_xref="PDB:3MRP"
FT                   /db_xref="PDB:3MRQ"
FT                   /db_xref="PDB:3MRR"
FT                   /db_xref="PDB:3MYJ"
FT                   /db_xref="PDB:3O3A"
FT                   /db_xref="PDB:3O3B"
FT                   /db_xref="PDB:3O3D"
FT                   /db_xref="PDB:3O3E"
FT                   /db_xref="PDB:3O4L"
FT                   /db_xref="PDB:3PWJ"
FT                   /db_xref="PDB:3PWL"
FT                   /db_xref="PDB:3PWN"
FT                   /db_xref="PDB:3PWP"
FT                   /db_xref="PDB:3QDG"
FT                   /db_xref="PDB:3QDJ"
FT                   /db_xref="PDB:3QDM"
FT                   /db_xref="PDB:3QEQ"
FT                   /db_xref="PDB:3QFD"
FT                   /db_xref="PDB:3QFJ"
FT                   /db_xref="PDB:3REW"
FT                   /db_xref="PDB:3TO2"
FT                   /db_xref="PDB:3UTQ"
FT                   /db_xref="PDB:3UTS"
FT                   /db_xref="PDB:3UTT"
FT                   /db_xref="PDB:3V5D"
FT                   /db_xref="PDB:3V5H"
FT                   /db_xref="PDB:3V5K"
FT                   /db_xref="PDB:4E5X"
FT                   /db_xref="PDB:4EMZ"
FT                   /db_xref="PDB:4EN2"
FT                   /db_xref="PDB:4EUP"
FT                   /db_xref="PDB:4EUQ"
FT                   /db_xref="PDB:4FTV"
FT                   /db_xref="PDB:4GKN"
FT                   /db_xref="PDB:4GKS"
FT                   /db_xref="PDB:4I4W"
FT                   /db_xref="PDB:4JFD"
FT                   /db_xref="PDB:4JFE"
FT                   /db_xref="PDB:4JFF"
FT                   /db_xref="PDB:4JFO"
FT                   /db_xref="PDB:4JFP"
FT                   /db_xref="PDB:4JFQ"
FT                   /db_xref="PDB:4K7F"
FT                   /db_xref="PDB:4L29"
FT                   /db_xref="PDB:4L3C"
FT                   /db_xref="PDB:4L3E"
FT                   /db_xref="PDB:4MNQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01892"
FT                   /protein_id="AAA03604.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWETAHEAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            1..73
FT   exon            74..343
FT   exon            344..619
FT   exon            620..895
FT   exon            896..1021
FT   exon            1022..1054
FT   exon            1055..1098
XX
SQ   Sequence 1098 BP; 222 A; 323 C; 368 G; 185 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggctct ggccctgacc        60
     cagacctggg cgggctctca ctccatgagg tatttcttca catccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggt       240
     ccggagtatt gggacgggga gacacggaaa gtgaaggccc actcacagac tcaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccgtccag       360
     aggatgtatg gctgcgacgt ggggtcggac tggcgcttcc tccgcgggta ccaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aaagaggacc tgcgctcttg gaccgcggcg       480
     gacatggcag ctcagaccac caagcacaag tgggagacgg cccatgaggc ggagcagtgg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cgcccccaaa acgcatatga ctcaccacgc tgtctctgac       660
     catgaagcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaca ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtttg cccaagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct       960
     gtgatcactg gagctgtggt cgctgctgtg atgtggagga ggaagagctc agatagaaaa      1020
     ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer