spacer

EBI Dbfetch

ID   M85223; SV 1; linear; genomic DNA; STD; HUM; 285 BP.
XX
AC   M85223;
XX
DT   12-AUG-1993 (Rel. 36, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human (clone DP-beta-NEWI) MHC class 2 lymphocyte antigen (HLA-DPB1) gene,
DE   exon 2.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-285
RA   Kimura A.;
RT   "Mia";
RL   Unpublished.
XX
DR   MD5; 7888e364fcf1238fb8dba1c1b9b8d756.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..285
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="PNG167"
FT                   /cell_type="granulocyte"
FT                   /db_xref="taxon:9606"
FT   intron          <1..19
FT                   /gene="HLA-DPB1"
FT                   /number=1
FT   CDS             <20..>283
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="lymphocyte antigen"
FT                   /note="exon 2"
FT                   /db_xref="GOA:Q29881"
FT                   /db_xref="IMGT/HLA:DPB1*10:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29881"
FT                   /protein_id="AAA35994.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEVYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRR"
FT   intron          284..>285
FT                   /gene="HLA-DPB1"
FT                   /number=2
XX
SQ   Sequence 285 BP; 61 A; 76 C; 103 G; 45 T; 0 other;
     gtccgccccc tccccgcaga gaattacctt ttccagggac ggcaggaatg ctacgcgttt        60
     aatgggacac agcgcttcct ggagagatac atctacaacc gggaggagtt cgtgcgcttc       120
     gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctga tgaggtgtac       180
     tggaacagcc agaaggacat cctggaggag gagcgggcag tgccggacag gatgtgcaga       240
     cacaactacg agctgggcgg gcccatgacc ctgcagcgcc gaggt                       285
//


spacer
spacer