spacer

EBI Dbfetch

ID   HM157283; SV 1; linear; genomic DNA; STD; HUM; 2052 BP.
XX
AC   HM157283;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I protein (HLA-B) gene, HLA-B*48 variant allele,
DE   exons 1 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2052
RA   Hwang S.H., Kwon O.J., Kang J.E., Song E.J., Kim H.H.;
RT   "Novel HLA-B*48 allele identified by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-2052
RA   Hwang S.H., Kwon O.J., Kang J.E., Song E.J., Kim H.H.;
RT   ;
RL   Submitted (27-APR-2010) to the INSDC.
RL   Laboratory Medicine, Pusan National University Hospital, 1-10 Ami-dong
RL   Seo-gu, Busan 602-739, Republic of Korea
XX
DR   MD5; ea077213d5b90fdc3de074a218dff37d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2052
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2052
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*48 variant"
FT   mRNA            join(<1..73,202..471,717..992,1567..1842,1936..>2052)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*48 variant"
FT                   /product="MHC class I protein"
FT   CDS             join(1..73,202..471,717..992,1567..1842,1936..>2052)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*48 variant"
FT                   /product="MHC class I protein"
FT                   /db_xref="GOA:D9ZNA7"
FT                   /db_xref="IMGT/HLA:B*48:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D9ZNA7"
FT                   /protein_id="ADK88901.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWTAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*48 variant"
FT                   /number=1
FT   exon            202..471
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*48 variant"
FT                   /number=2
FT   exon            717..992
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*48 variant"
FT                   /number=3
FT   exon            1567..1842
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*48 variant"
FT                   /number=4
FT   exon            1936..>2052
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*48 variant"
FT                   /number=5
XX
SQ   Sequence 2052 BP; 385 A; 632 C; 662 G; 373 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggtgagtg cgggtcggga gggaaatggc ctctgccggg aggagcgagg       120
     ggaccgcagg cgggggcgca ggacctgagg agccgcgccg ggaggagggt cgggcgggtc       180
     tcagcccctc ctcaccccca ggctcccact ccatgaggta tttctacacc tccgtgtccc       240
     ggcccggccg cggggagccc cgcttcatct cagtgggcta cgtggacgac acccagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga gagaggagcc gcgggcgccg tggatagagc       360
     aggaggggcc ggagtattgg gaccgggaga cacagatctc caagaccaac acacagactt       420
     accgagagag cctgcggaac ctgcgcggct actacaacca gagcgaggcc ggtgagtgac       480
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga       540
     gtctccgggt ccgagatccg cctccctgag gccgcgggac ccgcccagac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggac tgggctgacc gcggggccgg ggccagggtc       720
     tcacaccctc cagagcatgt acggctgcga cgtggggccg gacgggcgcc tcctccgcgg       780
     gcataaccag tacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgcgctc       840
     ctggaccgcc gcggacacgg cggctcagat ctcccagcgc aagttggagg cggcccgtgt       900
     ggcggagcag ctgagagcct acctggaggg cgagtgcgtg gagtggctcc gcagatacct       960
     ggagaacggg aaggacaagc tggagcgcgc tggtaccagg ggcagtgggg agccttcccc      1020
     atctcctata ggtcgccggg gatggcctcc cacgagaaga ggaggaaaat gggatcagcg      1080
     ctagaatgtc gccctccgtt gaatggagaa tggcatgagt tttcctgagt ttcctctgag      1140
     ggccccctct tctctctaga caattaagga atgacgtctc tgaggaaatg gaggggaaga      1200
     cagtccctag aatactgatc aggggtcccc tttgacccct gcagcagcct tgggaaccgt      1260
     gacttttcct ctcaggcctt gttctctgcc tcacactcag tgtgtttggg gctctgattc      1320
     cagcacttct gagtcacttt acctccactc agatcaggag cagaagtccc tgttccccgc      1380
     tcagagactc gaactttcca atgaatagga gattatccca ggtgcctgcg tccaggctgg      1440
     tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg tccattctca ggctggtcac      1500
     atgggtggtc ctagggtgtc ccatgaaaga tgcaaagcgc ctgaattttc tgactcttcc      1560
     catcagaccc cccaaagaca cacgtgaccc accaccccat ctctgaccat gaggccaccc      1620
     tgaggtgctg ggccctgggt ttctaccctg cggagatcac actgacctgg cagcgggatg      1680
     gcgaggacca aactcaggac actgagcttg tggagaccag accagcagga gatagaacct      1740
     tccagaagtg gacagctgtg gtggtgcctt ctggagaaga gcagagatac acatgccatg      1800
     tacagcatga ggggctgccg aagcctctca ccctgagatg gggtaaggag ggggatgagg      1860
     ggtcatatct cttctcaggg aaagcaggag cccttcagca gggtcagggc ccctcatctt      1920
     cccctccttt cccagagccg tcttcccagt ccaccgtccc catcgtgggc attgttgctg      1980
     gcctggctgt cctagcagtt gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga      2040
     ggaagagttc ag                                                          2052
//


spacer
spacer