spacer

EBI Dbfetch

ID   GQ302514; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   GQ302514;
XX
DT   10-SEP-2009 (Rel. 102, Created)
DT   10-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*12new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Faner R., Campos E., Caro P., Gil J., Mongay L., Ambros C., Mantecon S.,
RA   Herrero M.J., Pujol R., Palou E.;
RT   "Description of three new DRB1 alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Faner R., Campos E., Caro P., Gil J., Mongay L., Ambros C., Mantecon S.,
RA   Herrero M.J., Pujol R., Palou E.;
RT   ;
RL   Submitted (22-JUN-2009) to the INSDC.
RL   LIRAD, Banc de Sang i Teixits, Crta de Can Ruti, Badalona, Barcelona 08916,
RL   Spain
XX
DR   MD5; 69fa8ddec354f50a7843b159f43876e1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:C9DA77"
FT                   /db_xref="IMGT/HLA:DRB1*12:01:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C9DA77"
FT                   /protein_id="ACV51796.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 68 C; 98 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttactgga gagacacttc cataaccagg aggagctcct gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaagacagg cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer