Dbfetch

ID   FR751004; SV 1; linear; genomic DNA; STD; HUM; 1485 BP.
XX
AC   FR751004;
XX
DT   23-DEC-2010 (Rel. 107, Created)
DT   26-APR-2012 (Rel. 112, Last updated, Version 2)
XX
DE   Homo sapiens partial MICA for MHC class I polypeptide-related sequence A,
DE   allele MICA*010new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1485
RA   Zhang S.;
RT   ;
RL   Submitted (17-DEC-2010) to the INSDC.
RL   Zhang S., Immunohematology Research Center, Institute of Blood Transfusion,
RL   NO. 26 Huacailu, Dongsanhuanerduan, Chengdu, Sichuan, 610052, CHINA.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2011.01804.x.
RX   PUBMED; 22111573.
RA   Zhang S., Wang J., Luo M., Li X., Chen Q.;
RT   "Identification of a novel allele MICA*010:02";
RL   Tissue Antigens 79(3):216-217(2012).
XX
DR   MD5; 1009d56498b93d1f9aac7ae49390e10b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1485
FT                   /organism="Homo sapiens"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..255,356..643,744..1022,1123..1257,1358..1485)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*010new"
FT                   /product="MHC class I polypeptide-related sequence A"
FT                   /db_xref="GOA:E7BBQ2"
FT                   /db_xref="IMGT/HLA:MICA*010:02"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:E7BBQ2"
FT                   /protein_id="CBY85065.1"
FT                   /translation="PHSLPYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDAT
FT                   QLGFQPLMSALGSTGSTEGA"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="MICA*010new"
FT                   /number=2
FT   gap             256..355
FT                   /estimated_length=unknown
FT   exon            356..643
FT                   /gene="MICA"
FT                   /allele="MICA*010new"
FT                   /number=3
FT   gap             644..743
FT                   /estimated_length=unknown
FT   exon            744..1022
FT                   /gene="MICA"
FT                   /allele="MICA*010new"
FT                   /number=4
FT   gap             1023..1122
FT                   /estimated_length=unknown
FT   exon            1123..1257
FT                   /gene="MICA"
FT                   /allele="MICA*010new"
FT                   /number=5
FT   gap             1258..1357
FT                   /estimated_length=unknown
FT   exon            1358..>1485
FT                   /gene="MICA"
FT                   /allele="MICA*010new"
FT                   /number=6
XX
SQ   Sequence 1485 BP; 267 A; 285 C; 304 G; 229 T; 400 other;
     agccccacag tcttccttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttcttgc tgaggtacat ctggatggtc agcccttcct gcgctatgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngcttg       360
     cattccctcc aggagattag ggtctgtgag atccatgaag acaacagcac caggagctcc       420
     cagcatttct actacgatgg ggagctcttc ctctcccaaa acctggagac tgaggaatgg       480
     acagtgcccc agtcctccag agctcagacc ttggccatga acgtcaggaa tttcttgaag       540
     gaagatgcca tgaagaccaa gacacactat cacgctatgc atgcagactg cctgcaggaa       600
     ctacggcgat atctagaatc cagcgtagtc ctgaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacccgca gcgaggcctc       780
     agagggcaac atcaccgtga catgcagggc ttccagcttc tatccccgga atatcatact       840
     gacctggcgt caggatgggg tatctttgag ccacgacacc cagcagtggg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc gaggagagga       960
     gcagaggttc acctgctaca tggaacacag cgggaatcac agcactcacc ctgtgccctc      1020
     tgnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggaaagtg ctggtgcttc      1140
     agagtcattg gcagacattc cacgtttctg ctgttgctgc tgctgctgct atttttgtta      1200
     ttattatttt ctatgtccgt tgttgtaaga agaaaacatc agctgcagag ggtccagnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnagc tcgtgagcct gcaggtcctg      1380
     gatcaacacc cagttgggac gagtgaccac agggatgcca cacagctcgg atttcagcct      1440
     ctgatgtcag ctcttgggtc cactggctcc actgagggcg cctag                      1485
//