spacer

EBI Dbfetch

ID   FR718488; SV 1; circular; genomic DNA; STD; PRO; 1069 BP.
XX
AC   FR718488;
XX
PR   Project:PRJEA59689;
XX
DT   27-APR-2011 (Rel. 108, Created)
DT   27-APR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Yersinia enterocolitica W22703 biovar 2, serovar O:9, contig 7180000001066
XX
KW   .
XX
OS   Yersinia enterocolitica W22703
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Yersinia.
XX
RN   [1]
RP   1-1069
RA   Rattei T.;
RT   ;
RL   Submitted (02-NOV-2010) to the INSDC.
RL   Rattei T., Department of Computational Systems Biology, University of
RL   Vienna, Althanstr. 14, 1090 Vienna, AUSTRIA.
XX
RN   [2]
RX   DOI; 10.1186/1471-2164-12-168.
RX   PUBMED; 21453472.
RA   Fuchs T.M., Brandt K., Starke M., Rattei T.;
RT   "Shotgun sequencing of Yersinia enterocolitica strain W22703 (biotype 2,
RT   serotype O:9): genomic evidence for oscillation between invertebrates and
RT   mammals";
RL   BMC Genomics 12:168-168(2011).
XX
DR   MD5; ccaa0aebba70c2b93961be4ef8a77339.
DR   EuropePMC; PMC3079665; 21453472.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1069
FT                   /organism="Yersinia enterocolitica W22703"
FT                   /ecotype="Biovar 2"
FT                   /mol_type="genomic DNA"
FT                   /serovar="O:9"
FT                   /note="contig 7180000001066"
FT                   /db_xref="taxon:913028"
FT   CDS             <1..357
FT                   /transl_table=11
FT                   /gene="YEW_JL40810"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:F4MTX9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:F4MTX9"
FT                   /protein_id="CBX69286.1"
FT                   /translation="SFKLAVVEQVEKGEMTYRQAQDRYGIQGRSTVLKWLRKFGQLDWL
FT                   SPSPARMYGVNMPQMPLTPEQRIKELEQQLAESEVKAQFFEAVVKVMNTEFGATLTKKQ
FT                   LATLSRKHKRRDSQ"
FT   CDS             357..758
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="YEW_JL40820"
FT                   /product="unknown protein"
FT   CDS             806..>1069
FT                   /transl_table=11
FT                   /gene="YEW_JL40830"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:F4MTY0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:F4MTY0"
FT                   /protein_id="CBX69288.1"
FT                   /translation="MHESLHTRHVAAALKMAQLSRRTASALIHHSDRGIQYCSTEYQAL
FT                   HQRHGVICSMTDGYDCYQNALAERVNGILKLEYLLVKPEDIGQ"
XX
SQ   Sequence 1069 BP; 289 A; 258 C; 287 G; 235 T; 0 other;
     tcctttaaat tggccgttgt cgaacaggtc gaaaaagggg aaatgactta ccgacaggcg        60
     caagaccgct acggtattca aggccgttct accgtcctga agtggctacg caagttcggt       120
     caactcgact ggctttctcc ctctcctgca agaatgtacg gagttaacat gccccaaatg       180
     cctcttactc ccgaacagcg aattaaagag cttgaacagc aactcgctga atcagaagtc       240
     aaagctcagt tttttgaagc ggttgtgaag gtcatgaaca ctgagttcgg agccacactg       300
     acaaaaaagc agttggccac attatcacgc aagcacaagc gacgggactc acagtaacgc       360
     gcgcttgccg gttcatgggg attagccggc aggcgtggta tcagtctttg cagcgtgagc       420
     ggagaagaga aatacaggcc ccaaatatca ttgaacaagt gacgaccatc cggttacaac       480
     agccccggtt gggggcgcgt aaattgcatg acttgttgcg acaacaagca gaaccggcgc       540
     tgcatgttgg ccgagatcgc ctgttccaga tactgcgttg ctcgcggtta ctggtgatgc       600
     ctaaacgggc gtatcataaa acgacaaaca gccatcatcg cttttaccgt caccctaact       660
     tattgaaggg agggaagatc aggttattgc cagccacccg gaacaggtat gggtcgcgga       720
     tattacgtat cttccactgc gtaagggaaa ggcgtatgtg agtctggtca ctgacgcctg       780
     gtcgagaaaa atagtgggat atcatgtgca tgaaagcctg cacacccgcc atgtagccgc       840
     tgcgctcaaa atggcgcagt tgagcaggcg cacagcatct gcgctgatac atcactcaga       900
     ccggggtatc cagtactgtt caacagaata tcaggcgtta catcaacgtc acggcgtcat       960
     ctgttcgatg acggatggat atgattgcta tcagaatgcg ctggcggaac gggtaaatgg      1020
     gatattaaaa ctggaatatc tgctggttaa gccggaagat attggtcag                  1069
//


spacer
spacer