spacer

EBI Dbfetch

ID   FM992365; SV 1; linear; genomic DNA; STD; HUM; 904 BP.
XX
AC   FM992365;
XX
DT   27-JAN-2009 (Rel. 99, Created)
DT   27-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, allele
DE   HLA-DPB1*0501new, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-904
RA   Witter K.;
RT   ;
RL   Submitted (23-JAN-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Confirmation of several HLA-DPB1 alleles including exon 3";
RL   Unpublished.
XX
DR   MD5; c4015620b9d898d3019d2d271c799311.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..904
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<30..293,483..>764)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0501new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B9W6F8"
FT                   /db_xref="IMGT/HLA:DPB1*05:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6F8"
FT                   /protein_id="CAX30406.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVTE
FT                   LGRPEAEYWNSQKDILEEKRAVPDRMCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YICQVEHTSLDSPVTVEW"
FT   exon            30..293
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0501new"
FT                   /number=2
FT   intron          join(294..>309,<452..482)
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0501new"
FT                   /number=2
FT   gap             310..451
FT                   /estimated_length=142
FT   exon            483..764
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0501new"
FT                   /number=3
XX
SQ   Sequence 904 BP; 164 A; 223 C; 218 G; 157 T; 142 other;
     ctccgctcat gtccgccccc tccccgcaga gaattacctt ttccagggac ggcaggaatg        60
     ctacgcgttt aatgggacac agcgcttcct ggagagatac atctacaacc gggaggagct       120
     cgtgcgcttc gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctga       180
     ggcggagtac tggaacagcc agaaggacat cctggaggag aagcgggcag tgccggacag       240
     gatgtgcaga cacaactacg agctggacga ggccgtgacc ctgcagcgcc gaggtgagtg       300
     agggctttgn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nctatttcat tattttcctt ccccactcgt       480
     agtccagcct aaggtgaacg tttccccctc caagaagggg cccctgcagc accacaacct       540
     gcttgtctgc cacgtgacag atttctaccc aggcagcatt caagtccgat ggttcctgaa       600
     tggacaggag gaaacagctg gggtcgtgtc caccaacctg atccgtaatg gagactggac       660
     cttccagatc ctggtgatgc tggaaatgac cccccagcag ggagatgtct acatctgcca       720
     agtggagcac accagcctgg acagtcctgt caccgtggag tggagtgagt ctctgatgac       780
     cgtctagacc ccacctctga agagcagggg actctctggc tctggggtcc actcatctta       840
     tcttctgcat ctataccctg gggccatgtc caaaccccat ctttcttcta taccagctcc       900
     tgag                                                                    904
//


spacer
spacer