spacer

EBI Dbfetch

ID   EU871625; SV 1; linear; genomic DNA; STD; HUM; 1948 BP.
XX
AC   EU871625;
XX
DT   27-JUL-2008 (Rel. 96, Created)
DT   27-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*51 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1948
RA   Xiao L.;
RT   "Identification of a novel HLA-B*51 variant allele in Chinese Han
RT   population";
RL   Unpublished.
XX
RN   [2]
RP   1-1948
RA   Xiao L.;
RT   ;
RL   Submitted (04-JUL-2008) to the INSDC.
RL   NanFang Hospital, Southern Medical University, 1838 Northern GuangZhou Main
RL   Street, GuangZhou, GuangDong 510515, P. R. China
XX
DR   MD5; eada2b1022d59a8c713d0c4c1d039514.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1948
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1948
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 variant"
FT   mRNA            join(<1..73,203..472,718..993,1569..>1844)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,203..472,718..993,1569..>1844)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B5ARH3"
FT                   /db_xref="IMGT/HLA:B*51:59"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B5ARH3"
FT                   /protein_id="ACF57232.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
XX
SQ   Sequence 1948 BP; 370 A; 606 C; 634 G; 338 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggtgagtg cggggtcggg agggaaatgg cctctgtggg gaggagcgag       120
     gggaccgcag gcgggggcgc aggacctgag gagccgcgcc gggaggaggg tcgggcgggt       180
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc       240
     cggcccggcc gcggggagcc ccgcttcatt gcagtgggct acgtggacga cacccagttc       300
     gtgaggttcg acagcgacgc cgcgagtccg aggacggagc cccgggcgcc atggatagag       360
     caggaggggc cggagtattg ggaccggaac acacagatct tcaagaccaa cacacagact       420
     taccgagaga acctgcggat cgcgctccgc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       540
     agtctccggg tccgagatcc gcctccctga ggccgcggga cccgcccaga ccctcgaccg       600
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       660
     gttggtcggg gcggggcggg gctcggggga ctgggctgac cgcggggccg gggccagggt       720
     ctcacaccct ccagaggatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg       780
     ggcataacca gtacgcctac gacggcaaag attacatcgc cctgaacgag gacctgagct       840
     cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg       900
     aggcggagca gctgagagcc tacctggagg gcctgtgcgt ggagtggctc cgcagatacc       960
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1020
     catctcctat aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc      1080
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1140
     gggccccctc ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa      1200
     gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1260
     gtgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1320
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc      1380
     gctcagagac tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct      1440
     ggtgtctggg ttctgtgccc cttccccaca ccaggtgtcc tgtccattct caggctggtc      1500
     acatgggtgg tcctagggtg tcccatgaga gatgcaaagc gcctgaattt tctgactctt      1560
     cccatcagac cccccaaaga cacacgtgac ccaccacccc gtctctgacc atgaggccac      1620
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga      1680
     tggcgaggac caaactcagg acactgagct tgtggagacc agaccagcag gagatagaac      1740
     cttccagaag tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca      1800
     tgtacagcat gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga      1860
     ggggtcacat ctcttctcag ggaaagcagg agcccttctg gagcccttca gcagggtcag      1920
     ggcccctcgt cttcccctcc tttcccag                                         1948
//


spacer
spacer