spacer

EBI Dbfetch

ID   EF672087; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF672087;
XX
DT   09-AUG-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*1123 variant allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   He X., Shan X., Cui S., Li W., Liu N., Wang L., Wang Z., Wang L., Ni L.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   "A novel allele identified by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   He X., Shan X., Cui S., Li W., Liu N., Wang L., Wang Z., Wang L., Ni L.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   ;
RL   Submitted (12-JUN-2007) to the INSDC.
RL   HLA Lab, No.37 North Third Ring Road, Beijng 100088, China
XX
DR   MD5; a0e8b7b5d62ee177c9f2e27d1f0988f7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1123 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1123 variant"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1123 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A7L5K9"
FT                   /db_xref="IMGT/HLA:A*01:28"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A7L5K9"
FT                   /protein_id="ABS85167.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKME
FT                   PRAPWIEQEGPEYWDQETRNMKAHSQTDRVDLGTLRGYYNQSED"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1123 variant"
FT                   /number=2
FT   variation       209
FT                   /gene="HLA-A"
FT                   /replace="g"
FT                   /note="H69Q"
XX
SQ   Sequence 270 BP; 55 A; 83 C; 94 G; 38 T; 0 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagaa gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatatg aaggcccact cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg                                        270
//


spacer
spacer