spacer

EBI Dbfetch

ID   AM087469; SV 1; linear; genomic DNA; STD; HUM; 3095 BP.
XX
AC   AM087469;
XX
DT   26-OCT-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*0321
XX
KW   HLA-A gene; HLA-A*0321 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3095
RA   Cox S.T.;
RT   ;
RL   Submitted (26-SEP-2005) to the INSDC.
RL   Cox S.T., HLA Research Group, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "A*03XXN has an insertion in exon causing non-expression";
RL   Unpublished.
XX
DR   MD5; 665152840dba04b1bdbfefaf3d4913ac.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3095
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..73,204..473,715..990,1569..1845,1948..2064,
FT                   2507..2539,2722..2729,2857..2861)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT   CDS             join(1..73,204..473,715..990,1569..1609)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /product="MHC class I antigen"
FT                   /note="premature stop TGA; this allele is not detected
FT                   serologically"
FT                   /db_xref="GOA:Q3BK35"
FT                   /db_xref="IMGT/HLA:A*03:21N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BK35"
FT                   /protein_id="CAJ32464.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPQDTYDPPPHL"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=1
FT   intron          74..203
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=2
FT   intron          474..714
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=2
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=3
FT   intron          991..1568
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=3
FT   exon            1569..1845
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=4
FT   intron          1846..1947
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=4
FT   exon            1948..2064
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=5
FT   intron          2065..2506
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=5
FT   exon            2507..2539
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=6
FT   intron          2540..2721
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=6
FT   exon            2722..2729
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=7
FT   intron          2730..2856
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=7
FT   exon            2857..2861
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0321"
FT                   /number=8
XX
SQ   Sequence 3095 BP; 592 A; 883 C; 962 G; 658 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaaccg cctctgcggg gagaagcaag       120
     gggccctcct ggcgggggcg caggaccggg ggagccgcgc cgggacgagg gtcgggcagg       180
     tctcagccac tgctcgcccc caggctccca ctccatgagg tatttcttca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccagga gacacggaat gtgaaggccc agtcacagac       420
     tgaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccg ggggcgcagg tcaggacccc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggct gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc       720
     acaccatcca gataatgtat ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt       780
     accggcagga cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctctt       840
     ggaccgcggc ggacatggcg gctcagatca ccaagcgcaa gtgggaggcg gcccatgagg       900
     cggagcagtt gagagcctac ctggatggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcac cctccctctg gtcctgaggg agaggaatcc tcctgggttc cagatcctgt      1140
     accagagagt gactctgagg ttccgccctg ctctctgaca caattaaggg ataaaatctc      1200
     tgaaggagtg acgggaagac gatccctcga atactgatga gtggttccct ttgacaccgg      1260
     cagcagcctt gggcccgtga cttttcctct caggccttgt tctctgcttc acactcaatg      1320
     tgtgtggggg tctgagtcca gcacttctga gtccctcagc ctccactcag gtcaggacca      1380
     gaagtcgctg ttcccttctc agggaataga agattatccc aggtgcctgt gtccaggctg      1440
     gtgtctgggt tctgtgctct cttccccatc ccgggtgtcc tgtccattct caagatggcc      1500
     acatgcgtgc tggtggagtg tcccatgaca gatgcaaaat gcctgaattt tctgactctt      1560
     cccgtcagac cccccccaag acacatatga cccaccaccc catctctgac catgaggcca      1620
     ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca ggggatggaa      1740
     ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga tacacctgcc      1800
     atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggggtaag gagggagatg      1860
     ggggtgtcat gtctcttagg gaaagcagga gcctctctgg agacctttag cagggtcagg      1920
     gcccctcacc ttcccctctt ttcccagagc tgtcttccca gcccaccatc cccatcgtgg      1980
     gcatcattgc tggcctggtt ctccttggag ctgtgatcac tggagctgtg gtcgctgccg      2040
     tgatgtggag gaggaagagc tcaggtggag aaggggtgaa gggtggggtc tgagatttct      2100
     tgtctcactg agggttccaa gccccagcta gaaatgtgcc ctgtctcatt actgggaagc      2160
     accgtccaca atcatgggcc tacccagtct gggccctgtg tgccagcact tactcttttg      2220
     taaagcacct gttaaaatga aggacagatt tatcaccttg attacggcgg tgatgggacc      2280
     tgatcccagc agtcacaagt cacaggggaa ggtccctgag gacagacctc aggagggcta      2340
     ttggtccagg acccacacct gctttcttca tgtttcctga tcccgccctg ggtctgcagt      2400
     cacacatttc tggaaacttc tctggggtcc aagactagga ggttcctcta ggaccttaag      2460
     gccctggctc ctttctggta tctcacagga cattttcttc tcacagatag aaaaggaggg      2520
     agttacactc aggctgcaag taagtatgaa ggaggctgat gcctgaggtc cttgggatat      2580
     tgtgtttggg agcccatggg ggagcccacc cacctcacaa ttcctcctct agccacatct      2640
     tctgtgggat ctgaccaggt tctgtttttg ttctacccca ggcagtgaca gtgcccaggg      2700
     ctctgatgtg tccctcacag cttgtaaagg tgagagcttg gaggacctaa tgtgtgttgg      2760
     gtgttgggcg gaacagtgga cacagctgtg ctatggggtt tctttgcatt ggatgtattg      2820
     agcatgcgat gggctgttta aggtgtgacc cctcactgtg atggatatga atttgttcat      2880
     gaatattttt ttctatagtg tgagacagct gccttgtgtg ggactgagag gcaagagttg      2940
     ttcctgccct tccctttgtg acttgaagaa ccctgacttt gtttctgcaa aggcacctgc      3000
     atgtgtctgt gttcgtgtag gcataatgtg aggaggtggg gagaccaccc cacccccatg      3060
     tccaccatga ccctcttccc acgctgacct gtgct                                 3095
//


spacer
spacer