spacer

EBI Dbfetch

ID   AJ579654; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ579654;
XX
DT   01-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele HLA-B*40,
DE   exon 2
XX
KW   HLA-B gene; HLA-B*40 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Day S.;
RT   ;
RL   Submitted (31-JUL-2003) to the INSDC.
RL   Day S., H and I DNA Reference Laboratory, National Blood Service, Southmead
RL   Rd, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Dunn A., Carter V., Bendikidze N., Day S.;
RT   "Identifiacation of B*40variant gene";
RL   Unpublished.
XX
DR   MD5; 6a91c4e04fcbed38bf3f1f07188ab93f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YP21"
FT                   /db_xref="IMGT/HLA:B*40:14:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP21"
FT                   /protein_id="CAE22484.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEA"
FT   exon            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 87 C; 88 G; 35 T; 0 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer