- Course overview
- Search within this course
- What is antimicrobial resistance?
- How do we study pathogens?
- Public pathogen data
- A guide to the Pathogens Portal
- Analysing genomic data from pathogens
- Identification and investigation of antimicrobial resistance genes
- Data sharing
- The future of AMR
- Crossword: Test your knowledge
- Your feedback
- Further resources
- Help and support
- Glossary
- References
All materials are free cultural works licensed under a Creative Commons Attribution 4.0 International (CC BY 4.0) license, except where further licensing details are provided.
Mission 2: Protein pursuit
MGnify is also home to an extensive protein database which can be searched using HMMER. The search results provide information about the protein annotation, structure, and environments it is present in.
Below is a protein sequence for an antibiotic resistance gene. Copy the sequence and paste it into the protein search box, then press the submit button – this may take a few minutes!
MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR
Explore the results and have a go at answering the questions below.
For an extra challenge have a go at using UniProt’s ‘peptide search’ function to learn more about the protein!