Step 1: downloading the sequence of human IRAK2 and first approach modelling

Pencil iconGo to EBI Search and type IRAK2 in the search box. Find human IRAK2 and download the FASTA format sequence for it, or copy the sequence from here:

>sp|O43187|IRAK2_HUMAN Interleukin-1 receptor-associated kinase-like 2 OS=Homo sapiens GN=IRAK2 PE=1 SV=2 MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQAT
VQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPG
PGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF
NQNRKISQGTFADVYRGHRHGKPFVFKKLRETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQ
FHSFIYPYMANGSLQDRLQGQGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPK
LAHPMAHLCPVNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRS
PVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEKGAGRLPEDCAEALATAACLCLRRRNTSLQ
EVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDASSSMSVAPWAGAATPLLPTEN
GEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINEAKRKLMENILLYKEEKVDSIELFGP

Now go to the SWISS-MODEL service at the Swiss Institute of Bioinformatics. Click on the ‘Start modelling’ button and paste your sequence into the box. Click on ‘Build model’. SwissModel will automatically choose templates based on the most closely aligned protein sequence that has a three-dimensional structure available for it, and model a structure based on that (Figure 16).

Figure 16 Model results.

Controls

There are several approaches to assessing models. One is to check that values such as bond angles, distances etc. in the model match values that have been observed in experimentally derived structures. In SWISS-MODEL the QMEAN z-score represents an estimate of how comparable the model is to experimentally derived structures of similar size. QMEAN z-scores around zero indicate good agreement between the model structure and experimental structures of similar size. Models of low quality typically have scores of -4.0 or lower. The “thumbs-up” and “thumbs-down” symbols next to the score are used to indicate whether or not the model is of good quality (9). Another approach is to factor in observations of the quality of the alignment and template search method – this is represented in the GMQE (Global Model Quality Estimation) score. The GMQE score reflects the expected accuracy of that alignment and is expressed as a number between 0 and 1 where higher numbers indicate higher reliability (9). For more information see the SWISS-MODEL documentation pages.