Analyse a protein sequence

 

Scenario

You have isolated a protein from squirrel. You want to know more about this protein, perhaps the presence of certain domains or features can give you a clue about its role.

Exercise

Find information about the following protein using InterPro.

>squirrel_seq

MALPARLVPLCCLALLALPAQSCGPGRGPVGRRRYVRKQLVPLLYKQ

FVPSVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSG

ADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLH

YEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKA

GTVGGGCFRETEAAQLWGDARGLRELHRAWVLAADAAGRVVPTPVLL

FLDRDLQRRASFVAVETERPPRKLLLTPWHLVFAARGPAPAPGDFAP

VFARRLRAGDSVLAPGGDALRPARVARVAREEAVGVFAPLTAHGTLL

VNDVLASCYAVLESHQWAHRAFAPLRLLHALGALLPGGAVQPTGMHW

YSRFLYRLAEELLG