PDBe-KB: UniProt Coverage View:
Q5W271
![L-prolyl-[peptidyl-carrier protein] dehydrogenase in PDB entry 6af6, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/6af6_entity_1_front_image-200x200.png "Homo tetrameric assembly 1 of PDB entry <span class='highlight'>6af6</span> contains 4 copies of <span class='highlight'>L-prolyl-[peptidyl-carrier protein] dehydrogenase</span>. Front view.")
![L-prolyl-[peptidyl-carrier protein] dehydrogenase in PDB entry 6af6, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/6af6_entity_1_side_image-200x200.png "Homo tetrameric assembly 1 of PDB entry <span class='highlight'>6af6</span> contains 4 copies of <span class='highlight'>L-prolyl-[peptidyl-carrier protein] dehydrogenase</span>. Side view.")
![L-prolyl-[peptidyl-carrier protein] dehydrogenase in PDB entry 6af6, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/6af6_entity_1_top_image-200x200.png "Homo tetrameric assembly 1 of PDB entry <span class='highlight'>6af6</span> contains 4 copies of <span class='highlight'>L-prolyl-[peptidyl-carrier protein] dehydrogenase</span>. Top view.")
Chain: A
Length: 402 amino acids
Theoretical weight: 43.89 KDa
Source organism: Serratia sp. ATCC 39006
Expression system: Escherichia coli
UniProt:
FASTA Sequence
Length: 402 amino acids
Theoretical weight: 43.89 KDa
Source organism: Serratia sp. ATCC 39006
Expression system: Escherichia coli
UniProt:
- Canonical: Q5W271 (Residues: 1-386; Coverage: 100%)
FASTA Sequence
>pdb|6af6|A
MDFNLSNSQSDIYESAYRFACDVLDQDAQTRISQKILSTELWKKAAAYGFAHGPVSHQFGGSELGALDTALMIEALGKGSRDIGLSFSLCAHLCACVIPLYRFGSSELKDKYLESLVTGKLIAANAATEPDAGSDIYNMQATAQPCEGGYILNGKKIFITNAPIADVFIIYAKTNPDHGFLGVSAFLIEKGTPGLNVGEVIPKDCLSNCPWSEIVFNDIFIPQSQRIGMEGAGGAIFHDSMIWAKGCLSALFVGGLARLLETTLEYAKARQQFGKAIGQFQSVSNRIIDMKLRLEQCRLMLYRACWKHDQGQDAEADIAMSKLLISEYAVQSGLDAIQTFGGAAMDQELGLVRHLLNMIPSRIFSGTNDIQKEIIARKLGLRGTSSGSLVPRGSHHHHHHHH
PDBe-KB: UniProt Coverage View:
Q5W271