PDBe-KB: UniProt Coverage View:
O43674
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial in PDB entry 5xti, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/5xti_entity_24_front_image-200x200.png "Hetero 138-meric assembly 1 of PDB entry <span class='highlight'>5xti</span> contains 2 copies of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial in PDB entry 5xti, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/5xti_entity_24_side_image-200x200.png "Hetero 138-meric assembly 1 of PDB entry <span class='highlight'>5xti</span> contains 2 copies of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial in PDB entry 5xti, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/5xti_entity_24_top_image-200x200.png "Hetero 138-meric assembly 1 of PDB entry <span class='highlight'>5xti</span> contains 2 copies of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial</span>. Top view.")
Chains: Ba, a
Length: 138 amino acids
Theoretical weight: 16.57 KDa
Source organism: Homo sapiens
UniProt:
FASTA Sequence
Length: 138 amino acids
Theoretical weight: 16.57 KDa
Source organism: Homo sapiens
UniProt:
- Canonical: O43674 (Residues: 52-189; Coverage: 73%)
FASTA Sequence
>pdb|5xti|Ba a
KRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
PDBe-KB: UniProt Coverage View:
O43674