PDBe-KB: UniProt Coverage View:
O75380
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 5xth, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/5xth_entity_18_front_image-200x200.png "Hetero 80-meric assembly 1 of PDB entry <span class='highlight'>5xth</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 5xth, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/5xth_entity_18_side_image-200x200.png "Hetero 80-meric assembly 1 of PDB entry <span class='highlight'>5xth</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 5xth, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/5xth_entity_18_top_image-200x200.png "Hetero 80-meric assembly 1 of PDB entry <span class='highlight'>5xth</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Top view.")
Chain: T
Length: 95 amino acids
Theoretical weight: 10.58 KDa
Source organism: Homo sapiens
UniProt:
FASTA Sequence
Length: 95 amino acids
Theoretical weight: 10.58 KDa
Source organism: Homo sapiens
UniProt:
- Canonical: O75380 (Residues: 29-123; Coverage: 77%)
FASTA Sequence
>pdb|5xth|T
GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHH
PDBe-KB: UniProt Coverage View:
O75380