PDBe-KB: UniProt Coverage View:
O43677
![NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial in PDB entry 5xtc, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/5xtc_entity_14_front_image-200x200.png "Hetero 29-meric assembly 1 of PDB entry <span class='highlight'>5xtc</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial in PDB entry 5xtc, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/5xtc_entity_14_side_image-200x200.png "Hetero 29-meric assembly 1 of PDB entry <span class='highlight'>5xtc</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial in PDB entry 5xtc, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/5xtc_entity_14_top_image-200x200.png "Hetero 29-meric assembly 1 of PDB entry <span class='highlight'>5xtc</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial</span>. Top view.")
Chain: f
Length: 47 amino acids
Theoretical weight: 5.7 KDa
Source organism: Homo sapiens
UniProt:
FASTA Sequence
Length: 47 amino acids
Theoretical weight: 5.7 KDa
Source organism: Homo sapiens
UniProt:
- Canonical: O43677 (Residues: 28-74; Coverage: 62%)
FASTA Sequence
>pdb|5xtc|f
KFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNG
PDBe-KB: UniProt Coverage View:
O43677