PDBe-KB: UniProt Coverage View:
P48735
![Isocitrate dehydrogenase [NADP], mitochondrial in PDB entry 5i96, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/5i96_entity_1_front_image-200x200.png "Homo dimeric assembly 1 of PDB entry <span class='highlight'>5i96</span> contains 2 copies of <span class='highlight'>Isocitrate dehydrogenase [NADP], mitochondrial</span>. Front view.")
![Isocitrate dehydrogenase [NADP], mitochondrial in PDB entry 5i96, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/5i96_entity_1_side_image-200x200.png "Homo dimeric assembly 1 of PDB entry <span class='highlight'>5i96</span> contains 2 copies of <span class='highlight'>Isocitrate dehydrogenase [NADP], mitochondrial</span>. Side view.")
![Isocitrate dehydrogenase [NADP], mitochondrial in PDB entry 5i96, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/5i96_entity_1_top_image-200x200.png "Homo dimeric assembly 1 of PDB entry <span class='highlight'>5i96</span> contains 2 copies of <span class='highlight'>Isocitrate dehydrogenase [NADP], mitochondrial</span>. Top view.")
Chains: A, B
Length: 458 amino acids
Theoretical weight: 51.78 KDa
Source organism: Homo sapiens
Expression system: Spodoptera frugiperda
UniProt:
FASTA Sequence
Length: 458 amino acids
Theoretical weight: 51.78 KDa
Source organism: Homo sapiens
Expression system: Spodoptera frugiperda
UniProt:
- Canonical: P48735 (Residues: 1-452; Coverage: 100%)
FASTA Sequence
>pdb|5i96|A B
MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIQNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQHHHHHH
PDBe-KB: UniProt Coverage View:
P48735