![NADH dehydrogenase [ubiquinone] 1 subunit C2 in PDB entry 5gpn, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/5gpn_entity_57_front_image-200x200.png "Hetero 84-meric assembly 1 of PDB entry <span class='highlight'>5gpn</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 subunit C2</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 subunit C2 in PDB entry 5gpn, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/5gpn_entity_57_side_image-200x200.png "Hetero 84-meric assembly 1 of PDB entry <span class='highlight'>5gpn</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 subunit C2</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 subunit C2 in PDB entry 5gpn, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/5gpn_entity_57_top_image-200x200.png "Hetero 84-meric assembly 1 of PDB entry <span class='highlight'>5gpn</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 subunit C2</span>. Top view.")
Chain: Al
Length: 122 amino acids
Theoretical weight: 14.33 KDa
Source organism: Sus scrofa
Length: 122 amino acids
Theoretical weight: 14.33 KDa
Source organism: Sus scrofa
>pdb|5gpn|Al
MTMMSGRPGRVPLQFLPNEARSLPPPKLTDPRLVYMGFLGYCSGLIDNAIRRRPVVSAGLHRQLLYVTSFVFFGYYLLKRQDYMYALRDHDMFAYVKSHPEDFPEKDKKTYGEILEEFHPVR