Dionain-1

Chain: A
Length: 222 amino acids
Theoretical weight: 23.04 KDa
Source organism: Dionaea muscipula
Expression system: Komagataella pastoris
UniProt:
  • Canonical: A0A0E3GLN3 (Residues: 131-352; Coverage: 69%)
FASTA Sequence
>pdb|5a24|A
VPAAVDWRTAGAVTPVKNQQQCGCCWAFSAVAAIEGATQIKTGTLTSLSEEQIVDCDTNGNDKGCNGGTPDGAFQYVVNNQGIDTESDYPYTAGGGSPGTCSASSYQPAASITGYQDVPANNEQALQQAAATQPISVAIDASDPSFQSYSSGIYSGPCNTNLDHAVTVVGYGTDPNSGNSYWIVKNSWGTSWGQEGYIWMQMGLNAPYGVCGIAMQASYPTA