› › Transcription and mRNA export factor SUS1

Transcription and mRNA export factor SUS1 in PDB entry 4zux, assembly 1, front view.
Transcription and mRNA export factor SUS1 in PDB entry 4zux, assembly 1, side view.
Transcription and mRNA export factor SUS1 in PDB entry 4zux, assembly 1, top view.
Chains: V, a, f, k
Length: 96 amino acids
Theoretical weight: 11.09 KDa
Source organism: Saccharomyces cerevisiae S288C
Expression system: Escherichia coli
UniProt:
  • Canonical: Q6WNK7 (Residues: 1-96; Coverage: 100%)
Gene names: SUS1, YBR111W-A
FASTA Sequence
>pdb|4zux|V a f k
MTMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ
PDBe-KB: UniProt Coverage View: Q6WNK7  

Quick links

Search similar proteins