MCherry fluorescent protein

Chains: A, B, C
Length: 217 amino acids
Theoretical weight: 24.78 KDa
Source organism: Anaplasma marginale
Expression system: Escherichia coli
UniProt:
  • Canonical: X5DSL3 (Residues: 11-229; Coverage: 93%)
Gene name: mCherry
FASTA Sequence
>pdb|4zin|A B C
AIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGXEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTG