Gamma-crystallin B

Chain: A
Length: 181 amino acids
Theoretical weight: 21.95 KDa
Source organism: Bos taurus
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: P02526 (Residues: 1-175; Coverage: 100%)
Gene name: CRYGB
FASTA Sequence
>pdb|4w9b|A
MGKITFYEDRGFQGHCYECSSDCPNLQPYFSRCNSIRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFNDSIRSCRLIPQHTGTFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFYHHHHHH