SnoaL-like domain-containing protein

Chain: A
Length: 188 amino acids
Theoretical weight: 22.22 KDa
Source organism: [Clostridium] hylemonae DSM 15053
Expression system: Escherichia coli
UniProt:
  • Canonical: B4YSU1 (Residues: 1-169; Coverage: 100%)
Gene names: CLOHYLEM_06634, baiE
FASTA Sequence
>pdb|4l8o|A
MGSDKIHHHHHHENLYFQGMSIEERLEALEKEIQKMKDIEEIKKLKGQYFRCLDGKFWDELETTLSPNIVTSYSNGKLVFHGPKEVTDYFKKAMPREEISMHMGHTPEITIDSETTATGRWYLEDKLIFTEESKYAGSGVNGGAFYTDKYEKVDGKWYILETGYLRVYEEHFMRDPKIKITMNMHKTK