› › Transcription factor tau subunit sfc1

PDB 4bji contains 1 copy of Transcription factor tau subunit sfc1 in assembly 1. This protein is highlighted and viewed from the front.
PDB 4bji contains 1 copy of Transcription factor tau subunit sfc1 in assembly 1. This protein is highlighted and viewed from the side.
PDB 4bji contains 1 copy of Transcription factor tau subunit sfc1 in assembly 1. This protein is highlighted and viewed from the top.
Chain: A
Length: 215 amino acids
Theoretical weight: 25.18 KDa
Source organism: Schizosaccharomyces pombe 927
Expression system: Escherichia coli BL21
UniProt:
  • Canonical: O14229 (Residues: 186-396; Coverage: 46%)
Gene names: SPAC6F12.11c, sfc1, tfc1
FASTA Sequence
>pdb|4bji|A
GAMGKGQCRVWIITTNMGVESVPTCRHSKLGEPSKTIQEVIEALKPLFEKRPVWTRRALLNHLDPSYTHYLKFALPYLSYLWTSGPFRDTYTRFGYDPRKDSNAAAYQALFFKLKLNGKHKGTKTHVFDGKTLFPTNRVYQVCDIVDPTIAPLLKDTQLRSECHRDTGWYRSGRYYKVRDLMREKLFALIEGEMPSEVAVNMILNAEEVEESDRY

Visualisation

Quick links

Search similar proteins