Transcription factor tau subunit sfc1

Chain: A
Length: 215 amino acids
Theoretical weight: 25.18 KDa
Source organism: Schizosaccharomyces pombe 927
Expression system: Escherichia coli BL21
UniProt:
  • Canonical: O14229 (Residues: 186-396; Coverage: 46%)
Gene names: SPAC6F12.11c, sfc1, tfc1
FASTA Sequence
>pdb|4bji|A
GAMGKGQCRVWIITTNMGVESVPTCRHSKLGEPSKTIQEVIEALKPLFEKRPVWTRRALLNHLDPSYTHYLKFALPYLSYLWTSGPFRDTYTRFGYDPRKDSNAAAYQALFFKLKLNGKHKGTKTHVFDGKTLFPTNRVYQVCDIVDPTIAPLLKDTQLRSECHRDTGWYRSGRYYKVRDLMREKLFALIEGEMPSEVAVNMILNAEEVEESDRY