Transient receptor potential cation channel subfamily V member 1

Chain: B
Length: 37 amino acids
Theoretical weight: 4.08 KDa
Source organism: Rattus norvegicus
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: O35433 (Residues: 767-801; Coverage: 4%)
Gene names: Trpv1, Vr1, Vr1l
FASTA Sequence
>pdb|3sui|B
GPEGVKRTLSFSLRSGRVSGRNWKNFALVPLLRDAST