Peptidase, zinc-dependent

Chain: A
Length: 210 amino acids
Theoretical weight: 24.56 KDa
Source organism: Methanocorpusculum labreanum Z
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: A2SQK8 (Residues: 1-202; Coverage: 100%)
Gene name: Mlab_0438
FASTA Sequence
>pdb|3lmc|A
MGIHLFWDSRVPVGLSRPVSEELSAVLEMPVSRIDDGIFPLEGFDPVRNQYDAVKVLLKLDMFRRRMPQIFKPADMDLEFYNKFNHLHEKILLVTPGDLYEPLADFVFGLAYPKLGVAIVSPHRLQNEFYGKYADDSALIDRIVKEGAHEIGHLFGLGHCDNPGCIMYCPRNLDELDRKRKYFCGKCRVQLNGDTLEDDLFSLEHHHHHH