Insulin B chain

Chains: B, D
Length: 30 amino acids
Theoretical weight: 3.43 KDa
Source organism: Homo sapiens
UniProt:
  • Canonical: P01308 (Residues: 25-54; Coverage: 35%)
Gene name: INS
FASTA Sequence
>pdb|3inc|B D
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
PDBe-KB: UniProt Coverage View: P01308