Capsid protein G8P

Chain: A
Length: 46 amino acids
Theoretical weight: 4.61 KDa
Source organism: Pseudomonas virus Pf1
UniProt:
  • Canonical: P03621 (Residues: 37-82; Coverage: 85%)
Gene name: VIII
FASTA Sequence
>pdb|3ifm|A
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA