Superoxide dismutase

Chains: A, B
Length: 195 amino acids
Theoretical weight: 22.23 KDa
Source organism: Francisella tularensis subsp. tularensis
Expression system: Escherichia coli
UniProt:
  • Canonical: Q5NIJ9 (Residues: 1-192; Coverage: 100%)
Gene names: FTT_0068, sodB
FASTA Sequence
>pdb|3h1s|A B
SNAMKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIVKTSNGGIFNNAAQVFNHTFYWNCLTPNKTEASSQLKAALIETFGSVENFKEQFSKAAIATFGSGWAWLVKNTEGKLEIVTTSNAGCPLTENKKPLLTFDVWEHAYYIDYRNARPKYVEALWDIVNWQFVSEQFAD